spacer

EBI Dbfetch

ID   AF111107; SV 1; linear; mRNA; STD; MUS; 3691 BP.
XX
AC   AF111107;
XX
DT   11-MAR-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus transient receptor potential 2 (Trp2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3691
RX   DOI; 10.1073/pnas.96.5.2060.
RX   PUBMED; 10051594.
RA   Vannier B., Peyton M., Boulay G., Brown D., Qin N., Jiang M., Zhu X.,
RA   Birnbaumer L.;
RT   "Mouse trp2, the homologue of the human trpc2 pseudogene, encodes mTrp2, a
RT   store depletion-activated capacitative Ca2+ entry channel";
RL   Proc. Natl. Acad. Sci. U.S.A. 96(5):2060-2064(1999).
XX
RN   [2]
RP   1-3691
RA   Vannier B., Peyton M., Zhu X., Birnbaumer L.;
RT   ;
RL   Submitted (04-DEC-1998) to the INSDC.
RL   Anesthesiology, UCLA, 10833 Le Conte Avenue, Los Angeles, CA 90095-1778,
RL   USA
XX
DR   MD5; 963b551cca6b2c90b6741fb850ce8319.
DR   Ensembl-Gn; ENSMUSG00000070425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094129; mus_musculus.
DR   EuropePMC; PMC26736; 10051594.
DR   EuropePMC; PMC3006328; 20861471.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3691
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             390..3608
FT                   /codon_start=1
FT                   /gene="Trp2"
FT                   /product="transient receptor potential 2"
FT                   /note="putative capacitative calcium entry channel"
FT                   /db_xref="GOA:Q9R244"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR002706"
FT                   /db_xref="InterPro:IPR005458"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013555"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:109527"
FT                   /protein_id="AAD17195.1"
FT                   /translation="MGTKTHPVVPWSTKEISELKGMLKQLQPGPLGRAARMVLSAARKA
FT                   PPASVVSPNNSHGEPGPSRAESAEPRAEEPNRKTAVGRRKRRKVQEPRRSLSNSSSQPN
FT                   RRTGRTRQRQHRPQTKSDDGGVQAAGQCPICAGFFSIETLPQHAATCGESPPPQPASPA
FT                   SLSSSESVLRRHHVALTPVPLVPKPQPNWTEIVNKKLKFPPTLLRAIQEGQLGLVQQLL
FT                   ESSSDASGAGPGGPLRNVEESEDRSWREALNLAIRLGHEVITDVLLANVKFDFRQIHEA
FT                   LLVAVDTNQPAVVRRLLARLEREKGRKVDTKSFSLAFFDSSIDGSRFAPGVTPLTLACQ
FT                   KDLYEIAQLLMDQGHTIARPHPVSCACLECSNARRYDLLKFSLSRINTYRGIASRAHLS
FT                   LASEDAMLAAFQLSRELRRLARKEPEFKPQYIALESLCQDYGFELLGMCRNQSEVTAVL
FT                   NDLGEDSETEPEAEGLGQAFEEGIPNLARLRLAVNYNQKQFVAHPICQQVLSSIWCGNL
FT                   AGWRGSTTIWRLFVASLIFLTMPFLCIGYWLAPKSQLGRLLKIPVLKFLLHSASYLWFL
FT                   IFLLGESLVMETQLSTFKGRSQSVWETSLHMIWVTGFLWFECKEVWIEGLRSYLLDWWN
FT                   FLDVVILSLYLASFALRLLLAGLAYMHCRDASDSTTCRCFTTAERSEWRTEDPQFLAEV
FT                   LFTVTSMLSFTRLAYILPAHESLGTLQISIGKMIDDMIRFMFILMIILTAFLCGLNNIY
FT                   VPYQESEKLGNFNETFQFLFWTMFGMEEHTVVDMPQFLVPEFVGRAMYGIFTIVMVIVL
FT                   LNMLIAMITNSFQKIEDDADVEWKFARSKLYLSYFREGLTLPVPFNILPSPKAAFYLVR
FT                   RIFRFLCCGSSCCKAKKSDYPPIGTFTNPGARAGSAGEGERVSYRLRVIKALVQRYIET
FT                   ARREFEETRRKDLGNRLTELTKTVSRLQSEVASVQKNLAAGGAPRPPDGASILSRYITR
FT                   VRNSFQNLGPPTSDTPAELTMPGIVETEVSLGDGLDGTGEAGAPAPGEPGSSSSAHVLV
FT                   HREQEAEGSGDLLLEGDLETKGES"
XX
SQ   Sequence 3691 BP; 769 A; 1091 C; 1014 G; 817 T; 0 other;
     ccctgccacc atgctaatgt cccgcactga ctccaagtcg gggaagaacc gctcaggggt        60
     ccggatgttt aaagatggtg atttcctgac tccagcctca ggagagtcct gggatcgact       120
     tcgattgacc tgctcccaac ctttcacacg tcatcagtcc tttggcctgg ccttcctacg       180
     agtgcgttcc tctctgggct ctctggctga ccctgtagta gatccctcag cccctgggag       240
     ctctgggctt aaccagaact ctacagatgt gctggagtct gatcctaggc cctggctgac       300
     taatccttct atccggagga cattcttccc cgatccccag acgtatgtac ctgctgttga       360
     tatttctcaa ggacaaggcc atatagctca tgggcacaaa aacccatccc gtggtcccct       420
     ggagcaccaa ggaaatttca gagctcaagg gtatgttgaa gcagttgcag ccagggcctc       480
     tggggcgggc agcccgcatg gtgctttctg ctgcccgtaa ggcccctcca gccagtgtgg       540
     taagcccaaa caacagccac ggagaaccag gtcccagccg tgcagagagt gcagagccca       600
     gagcagaaga accaaacagg aagacggctg tgggcagaag gaagaggagg aaagtgcagg       660
     agccaaggag atcgttgtcc aactcgagtt ctcagccaaa taggaggaca ggaaggacaa       720
     gacaaagaca gcaccgacct cagaccaaaa gtgatgacgg tggtgtgcag gctgctggac       780
     agtgtcctat ttgtgcaggt ttcttcagta ttgagactct tccccagcat gctgcaactt       840
     gtggagagag ccccccaccc cagccagctt ctcctgcctc cttgtcttcc tcggagtccg       900
     tgctgagacg tcatcatgtg gcactaacac ccgttcccct tgtccccaag ccacagccca       960
     actggactga gattgtgaac aaaaagctca aattcccccc cacactcctg cgtgccatcc      1020
     aggagggcca gctgggtctt gtgcagcagc tgctggaatc cagttccgat gcctcgggtg      1080
     ctgggccagg tggtcctctg cggaatgtgg aagagtctga ggaccgctcc tggagggaag      1140
     ccctcaacct ggccatccgc ctgggccacg aggtcatcac tgatgttctg ctggccaatg      1200
     tcaaattcga ctttcggcag atccacgaag ccctgctagt ggctgtggac acaaaccagc      1260
     cagcagtggt gcgtcgcctg ctagcgcggc tggagcggga gaaaggtcga aaagtagaca      1320
     ccaagtcttt ctctctagcc ttctttgact catcgattga tggctcccgc tttgcccctg      1380
     gtgtcactcc actcacactg gcctgccaga aggacctgta tgagattgcc cagctgctta      1440
     tggaccaggg ccataccatt gctcggcccc acccagtttc ctgtgcctgc ctcgagtgca      1500
     gcaatgcccg ccgatacgac ctgctgaagt tctcactatc ccgaatcaac acctaccgag      1560
     gcattgcaag ccgggctcac ctctcgctgg ccagtgagga tgccatgctg gccgcttttc      1620
     agctcagccg ggagctcagg cgccttgcac gaaaggagcc tgagtttaag cctcagtaca      1680
     ttgccctgga gtctctctgc caggactatg gcttcgagtt gctgggcatg tgccgaaatc      1740
     agagtgaggt caccgcagtg ctcaatgacc tgggtgagga tagtgagact gagcctgagg      1800
     ctgagggcct gggtcaggcc tttgaggagg gcatccccaa cctggcaaga ctgcggttgg      1860
     ctgtcaacta caaccagaaa cagtttgtag cacatcccat ctgccagcaa gttctgtctt      1920
     ccatctggtg tgggaacctg gctggctggc gtggaagcac caccatctgg aggctctttg      1980
     ttgcctccct catcttcctc accatgccct tcctctgcat tggctactgg ctggcgccca      2040
     agtcccagct gggccgcctg ctgaagatcc cggtgctgaa gttcctgctg cattctgcct      2100
     cctacctgtg gttccttatc ttcttgctgg gagagtctct ggtcatggag acccagctga      2160
     gcaccttcaa aggccgcagc cagagtgtct gggagacttc actacatatg atctgggtca      2220
     caggcttcct atggtttgaa tgcaaggagg tgtggatcga gggcttgcgg agctacctcc      2280
     tggactggtg gaacttcctg gacgtggtca tcctgtccct gtacttggca tcctttgcac      2340
     tgcgcctcct cctggctggg cttgcctaca tgcactgccg tgatgcctca gacagcacca      2400
     cctgccgctg tttcaccaca gctgagagaa gtgagtggcg tacagaggac ccccagtttc      2460
     tggctgaggt gctctttact gtcaccagca tgctcagctt cacccgactg gcatatattc      2520
     tgccagctca cgaatcgctg ggcacactgc agatctccat cggcaagatg attgacgaca      2580
     tgatccggtt catgttcatc ctcatgatca tcctgactgc cttcctctgt ggcctcaaca      2640
     acatctatgt gccctaccag gaatccgaga agctaggcaa tttcaacgaa acgttccagt      2700
     ttctcttttg gaccatgttc ggcatggaag agcacacagt ggtggacatg cctcagttcc      2760
     tggtgcctga gttcgtgggc agggccatgt acggcatctt taccatcgtc atggtcattg      2820
     tgctacttaa catgcttatt gccatgatca ccaactcctt ccagaagatc gaggatgatg      2880
     ctgatgtgga gtggaagttt gctcgctcca agctctacct gtcctacttc cgagagggtc      2940
     tgacgctgcc tgtgcccttt aacatcctgc catccccaaa ggccgccttc tacctcgtca      3000
     ggagaatttt ccggttcctt tgctgtggct cctcctgctg caaagccaag aagtcggact      3060
     acccgcccat cgggaccttt accaaccccg gggcaagggc gggctccgcc ggggaaggag      3120
     aacgcgtgtc ctaccgcctt cgagtcatca aggctctggt gcagcgctac atagagactg      3180
     cccggcgcga gttcgaggag acccgtcgga aagacctggg caacagactg acagagctga      3240
     ccaagactgt gtctcgactg caaagcgagg tggccagtgt gcagaagaac ctggcggcgg      3300
     gaggggcacc acggcctccg gatggtgcca gcatcctcag tagatacatc acccgagtgc      3360
     gcaacagctt ccagaacctg ggccccccta cctctgacac cccagcagag ctgactatgc      3420
     ctgggattgt ggagaccgaa gtctctttag gagatggcct tgatggcaca ggtgaagctg      3480
     gagctcccgc tcctggagag cccggctctt cctcctctgc ccatgtgctg gttcacaggg      3540
     agcaagaagc agaggggtca ggggacttgc tcctggaagg agatctggag accaagggcg      3600
     agtcctaagg caacagaagg gtctcttctg tcactaagtg cagctgctgt gttgggtaga      3660
     gccagggtct cacagtagaa gaccatggtg c                                     3691
//


spacer
spacer