Dbfetch

ID   AF109160; SV 1; linear; mRNA; STD; MUS; 1969 BP.
XX
AC   AF109160;
XX
DT   01-DEC-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus Lutheran glycoprotein (Gplu) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1969
RX   DOI; 10.1007/s002510050602.
RX   PUBMED; 10630290.
RA   Rahuel C., Colin Y., Goossens D., Gane P., El Nemer W., Cartron J.P.,
RA   Le Van Kim C.;
RT   "Characterization of a mouse liminin receptor gene homologous to the human
RT   blood group Lutheran gene";
RL   Immunogenetics 50(5-6):271-277(1999).
XX
RN   [2]
RP   1-1969
RA   Rahuel C., Colin Y., Le Van Kim C.;
RT   ;
RL   Submitted (23-NOV-1998) to the INSDC.
RL   U76/INTS, INSERM, 6 Rue Alexandre Cabanel, Paris 75015, France
XX
DR   MD5; b0a6b91ebae3487ddb59d24a7a3c5bd0.
DR   Ensembl-Gn; ENSMUSG00000002980; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031795; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031771; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031697; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031776; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031498; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032242; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030841; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031460; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031615; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031567; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031698; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031603; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032270; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030565; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030941; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003061; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082064; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0082141; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0082079; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082086; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0081697; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082564; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082218; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0081638; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0081797; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0081673; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0081832; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0081696; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0082834; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0081644; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0080747; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1969
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /note="kidney"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..62
FT                   /gene="Gplu"
FT   CDS             63..1931
FT                   /codon_start=1
FT                   /gene="Gplu"
FT                   /product="Lutheran glycoprotein"
FT                   /note="adhesion molecule, erythroid laminin receptor"
FT                   /db_xref="GOA:Q9R069"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="MGI:MGI:1929940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R069"
FT                   /protein_id="AAF14226.1"
FT                   /translation="MEPPDARAGLLWLTFLLSGYSGAQAELHVSVPPRVEVMRGEQVAL
FT                   DCTPREHPEHYVLEWFLVDGTGARHRLASVEPQGSEFLGTVHSLGRVPPYEVDSRGRLV
FT                   IAKVQVGDGRDYVCVVKAGAAGTSEATSSVRVFATPEDTEVSPNKGTLSVMDQFAQEIA
FT                   TCSSNNGNPVPRITWYRNGQRLEVPMEVNQKGYITIRTVREASGLYSLTSTLYLRLHKD
FT                   DRDANFHCAAHYDLPSGQHGRLDSHTFRLTLHYPTEHVEFWVGSPSTTEGWVREGDAVQ
FT                   LLCQGDGSPSPEYSFFRQQGTQEEQLNVNLKGNLTLERVHRNQSGIYGCRVEDYDADEE
FT                   VQLVKKLKLHVAYLDPLELSVPEELFVFLNSSSTVVNCSARGLPTPTVRWTKDSVTLAD
FT                   GPMLSLQSVTFDSAGTYTCEASTPTVPLLSRTQSFQLIVQGAPELKPNEIMPKSGNSWT
FT                   EGDEVMLTCSARGFPEPKLTWSQRGDTPAEPPFEGRGWKSSSLMVKVTSALSREGVSCE
FT                   ASNIHGKKGHVFHFGSVAPQTAQAGVAVMAVAVSVGLLLLVVAAFYCMRRKGRPGCCRR
FT                   AEKGAPPAREPELSHSGSERPEHTGLLMGGPSGGGRGGSGGFGDEC"
FT   3'UTR           1932..>1969
FT                   /gene="Gplu"
XX
SQ   Sequence 1969 BP; 410 A; 580 C; 605 G; 374 T; 0 other;
     gccagcttca gggcggcgga gagcctcgcc cgggctcagt cactgccgcc actgcaggga        60
     acatggaacc ccctgacgcc cgcgcagggc tgctgtggct caccttcctg ctgtcgggct       120
     actcaggtgc ccaggctgag ctgcacgtgt ccgtgccccc acgggtggag gtgatgcgag       180
     gcgagcaagt cgccctggac tgcactccac gggagcaccc tgagcattac gtactggaat       240
     ggttcctcgt tgatggtact ggggctcgac accgtctggc ttctgtggaa ccacagggct       300
     cagagttcct gggcacagtc cactctctgg gccgcgtacc cccatacgag gtagactctc       360
     gtgggcgcct ggtgatagca aaggtccagg tgggcgatgg acgggactac gtgtgcgtag       420
     tgaaggctgg ggcagcgggt acctcagagg ccacctcaag tgtccgtgtg tttgcaacac       480
     cagaggatac ggaggtgtct cccaacaaag ggacgctgtc tgtgatggac cagtttgccc       540
     aggagattgc cacctgcagc agcaacaacg gaaaccccgt gcctcggatc acatggtacc       600
     gaaacgggca gcgtctggaa gtacccatgg aggtgaacca aaagggctac ataaccatcc       660
     gtactgtccg ggaagcctca ggcctgtact ccctgaccag caccctctac ctgaggctgc       720
     acaaggatga tcgggatgcc aacttccact gtgctgctca ctacgacttg ccctcaggcc       780
     aacatggccg cctggacagc catacctttc gcctcaccct gcactatccc acggaacatg       840
     tagaattctg ggtggggagc ccgtccacca cggagggctg ggtccgtgag ggtgatgctg       900
     tccagctgct ctgccagggc gatggcagcc ccagcccaga gtattctttt ttccgccagc       960
     agggtaccca ggaggaacag ctgaatgtca acctcaaggg aaacttgacc ctagaacggg      1020
     tgcatcggaa ccagagcggg atctacggct gcagagtgga ggattacgat gccgacgagg      1080
     aagtgcaact tgtcaagaag ctaaagctgc acgtggccta cctggatcca ttggagctga      1140
     gcgtgcctga ggagctcttt gtattcctga acagcagcag cacggtggtg aactgctccg      1200
     ctagaggcct gcctactcct actgtgcgat ggaccaagga ttctgtgacc cttgcagacg      1260
     gccccatgct ctctctccag tctgtgacct ttgactcagc tggcacctat acctgtgagg      1320
     cgtccacacc cacagtcccc ctcctgagcc gcacacagag tttccagctc atcgtccaag      1380
     gagcaccaga gttaaaaccg aatgagataa tgcccaaatc agggaatagc tggacagaag      1440
     gcgatgaagt catgctgacc tgctccgccc ggggcttccc agagcccaaa ctcacctgga      1500
     gtcagcgagg cgatactcca gcagagccgc cctttgaggg tagaggctgg aagagcagct      1560
     cgctgatggt gaaagtgacc agcgccctga gccgagaggg cgtgtcctgt gaagcgtcta      1620
     acatccatgg caagaaaggc catgtcttcc actttggctc tgtggcccct cagactgccc      1680
     aggctggagt ggctgtcatg gctgtagctg tcagcgtcgg tcttttgcta ctcgtggtcg      1740
     ctgctttcta ttgcatgaga cgcaaagggc gccctggctg ctgccggcga gcagagaaag      1800
     gggcgccgcc agccagggaa ccggagttga gccactctgg gtcagagcgg ccagaacaca      1860
     cgggccttct catgggtggg ccctccggag gaggcagagg tggcagtgga ggctttggag      1920
     atgagtgttg aggctgacga cctcccagag gcaatctctg gatctgccg                  1969
//