spacer

EBI Dbfetch

ID   AF104223; SV 1; linear; mRNA; STD; MUS; 1512 BP.
XX
AC   AF104223;
XX
DT   22-JUL-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mutant p53 binding protein 1 (Mbp1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1512
RX   DOI; 10.1038/sj.onc.1202937.
RX   PUBMED; 10380882.
RA   Gallagher W.M., Argentini M., Sierra V., Bracco L., Debussche L.,
RA   Conseiller E.;
RT   "MBP1: a novel mutant p53-specific protein partner with oncogenic
RT   properties";
RL   Oncogene 18(24):3608-3616(1999).
XX
RN   [2]
RP   1-1512
RA   Gallagher W.M., Argentini M., Sierra V., Bracco L., Debussche L.,
RA   Conseiller E.;
RT   ;
RL   Submitted (03-NOV-1998) to the INSDC.
RL   Oncology Department, Rhone-Poulenc Rorer, CRVA, 13 Quai Jules Guesde, Vitry
RL   sur Seine Cedex 94400, France
XX
DR   MD5; a939034b5b45518dd9884da3c6d5efb6.
DR   Ensembl-Gn; ENSMUSG00000024909; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070118; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165485; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1512
FT                   /organism="Mus musculus"
FT                   /strain="C57Bl/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="8.5 day embryos"
FT                   /db_xref="taxon:10090"
FT   CDS             48..1379
FT                   /codon_start=1
FT                   /gene="Mbp1"
FT                   /product="mutant p53 binding protein 1"
FT                   /note="MBP1"
FT                   /db_xref="GOA:Q9WVJ9"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001491"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="InterPro:IPR026824"
FT                   /db_xref="MGI:MGI:1891209"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVJ9"
FT                   /protein_id="AAD45219.1"
FT                   /translation="MLPFASCLPGSLLLWAFLLLLLGAASPQDPEEPDSYTECTDGYEW
FT                   DADSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVISDLHGEGPPPPAAHAQ
FT                   QPNPCPQGYEPDEQESCVDVDECTQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECV
FT                   DIDECRYRYCQHRCVNLPGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYG
FT                   TFLCRCNQGYELHRDGFSCSDIDECGYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLC
FT                   QDIDECETGAHQCSEAQTCVNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQP
FT                   SSIVHRYMSITSERSVPADVFQIQATSVYPGAYNAFQIRSGNTQGDFYIRQINNVSAML
FT                   VLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF"
XX
SQ   Sequence 1512 BP; 319 A; 444 C; 410 G; 339 T; 0 other;
     ctgtggcaga aacccctgac ttctgcccac cacctcccag cctcaggatg ctcccttttg        60
     cctcctgcct ccccgggtct ttgctgctct gggcgtttct gctgttgctc ttgggagcag       120
     cgtccccaca ggatcccgag gagccggaca gctacacgga atgcacagat ggctatgagt       180
     gggatgcaga cagccagcac tgccgggatg tcaacgagtg cctgaccatc ccggaggctt       240
     gcaagggtga gatgaaatgc atcaaccact acgggggtta tttgtgtctg cctcgctctg       300
     ctgccgtcat cagtgatctc catggtgaag gacctccacc gccagcggcc catgctcaac       360
     aaccaaaccc ttgcccgcag ggctacgagc ctgatgaaca ggagagctgt gtggatgtgg       420
     acgagtgtac ccaggctttg catgactgtc gccctagtca ggactgccat aaccttcctg       480
     gctcctacca gtgcacctgc cctgatggtt accgaaaaat tggacccgaa tgtgtggaca       540
     tagatgagtg tcgttaccgc tattgccagc atcgatgtgt gaacctgccg ggctcttttc       600
     gatgccagtg tgagccaggc ttccagttgg gacctaacaa ccgctcttgt gtggatgtga       660
     atgagtgtga catgggagcc ccatgtgagc agcgctgctt caactcctat gggaccttcc       720
     tgtgtcgctg taaccagggc tatgagctgc accgggatgg cttctcctgc agcgatatcg       780
     atgagtgcgg ctactccagt tacctctgcc agtaccgctg tgtcaacgag ccaggccgat       840
     tctcctgtca ctgcccacaa ggctaccagc tgctggctac aaggctctgc caagatattg       900
     acgagtgtga aacaggtgca caccaatgtt ctgaggccca aacctgtgtc aacttccatg       960
     ggggttaccg ctgtgtggac accaaccgtt gtgtggagcc ctatgtccaa gtgtcagaca      1020
     accgctgcct ctgccctgcc tccaatcccc tttgtcgaga gcagccttca tccattgtgc      1080
     accgctacat gagcatcacc tcagagcgaa gtgtgcctgc tgacgtgttt cagatccagg      1140
     caacctctgt ctaccctggt gcctacaatg cctttcagat ccgttctgga aacacacagg      1200
     gggacttcta cattaggcaa atcaacaatg tcagcgccat gctggtcctc gccaggccag      1260
     tgacgggacc ccgggagtac gtgctggacc tggagatggt caccatgaat tcccttatga      1320
     gctaccgggc cagctctgta ctgagactca cggtctttgt gggagcctat accttctgaa      1380
     gaccctcagg gaagggccat gtgggggccc cttccccctc ccatagctta agcagccccg      1440
     ggggcctagg gatgaccgtt ctgcttaaag gaactatgat gtgaaggaca ataaagggag      1500
     aaagaaggaa aa                                                          1512
//


spacer
spacer