spacer

EBI Dbfetch

ID   AF102887; SV 1; linear; mRNA; STD; MUS; 3160 BP.
XX
AC   AF102887;
XX
DT   12-NOV-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus thrombospondin-4 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3160
RX   DOI; 10.1007/s003359901149.
RX   PUBMED; 10501972.
RA   Newton G., Weremowicz S., Morton C.C., Jenkins N.A., Gilbert D.J.,
RA   Copeland N.G., Lawler J.;
RT   "The thrombospondin-4 gene";
RL   Mamm. Genome 10(10):1010-1016(1999).
XX
RN   [2]
RP   1-3160
RA   Newton G., Lawler J.;
RT   ;
RL   Submitted (29-OCT-1998) to the INSDC.
RL   Pathology, Beth Israel Deaconess Medical Center, 99 Brookline Avenue,
RL   Boston, MA 02215, USA
XX
DR   MD5; 17ff04c17b8e5c05c66e7c5adaf1496a.
DR   Ensembl-Gn; ENSMUSG00000021702; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022213; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3160
FT                   /organism="Mus musculus"
FT                   /chromosome="13"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             86..2977
FT                   /codon_start=1
FT                   /product="thrombospondin-4"
FT                   /note="extracellular matrix protein"
FT                   /db_xref="GOA:Q9Z1T2"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR008859"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017897"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR024665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="MGI:MGI:1101779"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1T2"
FT                   /protein_id="AAC73003.1"
FT                   /translation="MPAPRAAAAAFLLLHLVLQPWQRTSAQATPQVFDLLPSSSQRLNP
FT                   SALQPVLTDPTLHEVYLISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRY
FT                   LKNDGKIHLVVFNNLQLADGRRHRVLLRLSNLQRGDGSVELYLDCAQADSVRNLPRAFS
FT                   GLTQNPESIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFN
FT                   RQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAP
FT                   PAPPTRPTRHCDSSPCFRGVRCTDTRDGFQCGPCPDGYTGNGITCSDVDECKYHPCYPG
FT                   VRCVNLAPGFRCDACPVGFTGPMVQGVGINFAKTNKQVCTDVDECQNGACVLNSICINT
FT                   LGSYRCGPCKPGYTGDQTRGCKTERSCRNPEQNPCSVHAQCIEERQGDVTCVCGVGWAG
FT                   DGYVCGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDG
FT                   ILNEQDNCVLTHNIDQRNSDKDIFGDACDNCRMVLNNDQKDTDGDGRGDACDDDMDGDG
FT                   IKNILDNCPRVPNRDQQDRDGDDVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDG
FT                   DGHQDSTDNCPTVINSSQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQE
FT                   DSNNDGVGDICEADFDQDQVIDHIDVCPENAEITLTDFRAYQTVVLDPEGDAQIDPNWV
FT                   VLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYV
FT                   VMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKD
FT                   SRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQ
FT                   ENIIWSNLKYRCNDTIPEDFQEFQTQSFDRLDN"
XX
SQ   Sequence 3160 BP; 815 A; 826 C; 854 G; 665 T; 0 other;
     cccgaggcca gcaaacagcg ccctacgccg gcaaagccac gccacattgt cgcctgcaca        60
     gccctcaggg agcagaagag tcaccatgcc ggccccacgc gcggccgcgg ccgccttcct       120
     cctgctgcac ctggtcctgc agccgtggca gcggacgagc gcccaggcca caccccaggt       180
     ctttgatctt ctaccgtcct ccagccagag gctgaacccc agcgccctgc agccagtcct       240
     gacagatccc accctgcacg aagtctatct catctccacc ttcaagctgc agagtaaaag       300
     ctcagccacc atctttggcc tctactcctc aagtgacaac agcaaatact ttgaattcac       360
     tgtgatggga cggctgaaca aagccatcct ccgctacctg aagaatgatg gaaagatcca       420
     tctggtggtg ttcaacaact tgcagctggc tgatgggagg cgccacaggg ttctcctgag       480
     actgagcaat ttgcagagag gagatggctc tgtagaactc tacctggact gcgctcaggc       540
     ggactcggtg cgcaacctcc ccagagcctt ttctggcctc acccagaacc cagagtccat       600
     tgaattgcgg acattccaga ggaagcccca ggacttcttg gaagagctga agctggtggt       660
     gcggggctcg ctgttccagg tggccagcct ccaagactgc ttcctgcagc agagtgagcc       720
     tctggctgcc acaagcacag gagactttaa tcgacagttc ttgggtcaaa tgacacaact       780
     gaaccagctc cttggagagg tgaaagatct tctgaggcag caggtcaagg aaacatcgtt       840
     tttgcgaaac accattgctg aatgccaagc ttgtggtcct ctcagctttc agtccccaac       900
     tccaaacaca ctggtgccca tagctcctcc agcaccccca actcgcccaa cacgccactg       960
     tgactccagc ccttgtttcc gaggtgtccg atgtacggac accagggatg gcttccagtg      1020
     tggaccctgc ccagatggtt acacgggaaa cgggatcacc tgctctgacg tggatgagtg      1080
     caaataccat ccctgctatc caggtgtgcg ctgtgtgaat ttggctccgg gtttcagatg      1140
     tgacgcctgt ccagtaggtt tcacagggcc catggtgcag ggtgtcggga tcaactttgc      1200
     taaaacaaac aagcaggtgt gcactgatgt tgatgagtgt cagaatggag cgtgtgttct      1260
     gaattctatc tgcattaaca ctttgggatc ttatcgctgt gggccttgca aaccagggta      1320
     cactggtgat cagacgaggg gatgcaagac tgaaaggagc tgccggaacc cagagcagaa      1380
     cccatgcagt gtgcatgcgc agtgcattga ggagcggcaa ggggatgtga cgtgtgtgtg      1440
     tggtgttggc tgggctggtg acggctatgt ctgtggaaag gatgtggaca ttgacagtta      1500
     ccctgatgaa gaactgccat gctctgccag gaactgcaag aaggataact gcaagtatgt      1560
     gccaaactct ggccaggaag atgcagacag agatggcatc ggagacgcgt gtgatgagga      1620
     tgcagatgga gatgggatct tgaatgaaca ggacaactgt gtcctgactc acaatataga      1680
     ccaaaggaac agtgataaag atatctttgg ggatgcctgt gacaactgcc ggatggtcct      1740
     gaataatgac cagaaggata ctgacgggga tgggagagga gacgcctgtg atgacgacat      1800
     ggatggagat ggaataaaaa acattttgga caactgtccc agagttccca accgtgacca      1860
     gcaggatcgg gatggtgatg atgtcggaga cgcttgtgac agctgtcctg atgtcagtaa      1920
     ccctaaccag tcggatgtgg ataacgatct ggttggggac tcctgtgaca ccaaccaaga      1980
     cagtgacggg gatggccacc aggacagcac agacaactgc cccacagtca ttaacagctc      2040
     ccagctggac actgacaaag atgggatcgg cgatgaatgt gatgacgatg acgataacga      2100
     tggcatccca gacctggtgc ctcctggccc agacaactgc aggctcgtcc ccaacccagc      2160
     ccaggaagat agcaacaatg acggggtagg agatatctgt gaagctgact tcgaccagga      2220
     ccaggtcatc gatcacattg atgtgtgccc tgagaatgcg gagatcaccc tgactgactt      2280
     cagggcctac cagacagtgg tcctggaccc tgaaggggat gctcagatcg accccaactg      2340
     ggtggtcctg aaccagggca tggaaattgt gcagaccatg aacagtgacc ctggcctagc      2400
     tgttgggtac acggcattta acggagttga ctttgaaggg accttccacg taaacaccca      2460
     gacagatgat gactatgctg gctttatttt tggttaccaa gacagctcca gcttctatgt      2520
     agtcatgtgg aagcaaacgg agcagacata ctggcaggct acaccgttcc gtgcagtagc      2580
     agaacctggt attcagctca aggctgtgaa gtctaaaact ggcccagggg aacatctccg      2640
     aaactccctg tggcacacag gggacaccag cgaccaggtc aggctgctgt ggaaggactc      2700
     caggaatgtg ggctggaagg acaaggtctc ctaccgctgg ttcctgcagc ataggcccca      2760
     ggtgggctac atcagggtgc gcttttatga aggctcggag ttggtggctg actctggggt      2820
     caccatagac accaccatgc gtggaggccg acttggtgtg ttctgcttct ctcaagaaaa      2880
     catcatctgg tccaacctca agtaccgctg caacgacacc ataccagagg acttccagga      2940
     gttccagacc cagagttttg accgcttgga taattgagcc aagaagcaat cccacaactg      3000
     ccttctcaaa caccaaagca acatcttttt taaaacttcc tataattctc tttatattat      3060
     catggctttt cttttaccag cccaaatacg tcaaaacttt ttatatgaat gtggaaataa      3120
     agaagagact atttctaata agaaaaaaaa aaaaaaaaaa                            3160
//


spacer
spacer