spacer

EBI Dbfetch

ID   AF098867; SV 1; linear; genomic DNA; STD; MUS; 1089 BP.
XX
AC   AF098867;
XX
DT   29-APR-1999 (Rel. 59, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus sp. 129SV V3/V1b vasopressin receptor gene, exon 2 and complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1089
RX   DOI; 10.1677/jme.0.0220251.
RX   PUBMED; 10343284.
RA   Ventura M.A., Rene P., de Keyzer Y., Bertagna X., Clauser E.;
RT   "Gene and cDNA cloning and characterization of the mouse V3/V1b pituitary
RT   vasopressin receptor";
RL   J. Mol. Endocrinol. 22(3):251-260(1999).
XX
RN   [2]
RP   1-1089
RA   Ventura M.A., Rene P., de Keyzer Y., Bertagna X., Clauser E.;
RT   ;
RL   Submitted (14-OCT-1998) to the INSDC.
RL   CHU Cochin, Universite Paris V, GEPE, UPR 1524 CNRS and ICGM, 24 rue du
RL   Faubourg Saint Jacques, Paris F-75014, France
XX
DR   MD5; 6585ca2f0c6cbc97f20063a822686468.
DR   Ensembl-Gn; ENSMUSG00000026432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027690; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1089
FT                   /organism="Mus musculus"
FT                   /strain="129SV"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(AF098866.1:<4889..5819,476..>810)
FT                   /product="V3/V1b vasopressin receptor"
FT   CDS             join(AF098866.1:4889..5819,476..810)
FT                   /codon_start=1
FT                   /product="V3/V1b vasopressin receptor"
FT                   /db_xref="GOA:Q9WU02"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000628"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1347010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WU02"
FT                   /protein_id="AAD27957.1"
FT                   /translation="MDSEPSWTATPSPGGTLFVPNTTTPWLGRDEELAKVEIGILATVL
FT                   VLATGGNLAVLLILGLQGHKRSRMHLFVLHLALTDLGVALFQVLPQLLWDITYRFQGSD
FT                   LLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPSQSTYPLIAAPWLLAAI
FT                   LSLPQVFIFSLREVIQGSGVLDCWADFYFSWGPRAYITWTTMAIFVLPVVVLTACYGLI
FT                   CHEIYKNLKVKTQAGREERRGWPKSSSSAAAAATRGLPSRVSSISTISRAKIRTVKMTF
FT                   VIVLAYIACWAPFFSVQMWSVWDENAPNEDSTNVAFTISMLLGNLSSCCNPWIYMGFNS
FT                   HLLPRSLSHRACCRGSKPRVHRQLSNSSLASRRTTLLTHTCGPSTLRLSLNLSLHAKPK
FT                   PAGSLKDLEQVDGEATMETSIS"
FT   exon            476..810
FT                   /number=2
XX
SQ   Sequence 1089 BP; 239 A; 319 C; 242 G; 289 T; 0 other;
     tttttaaaaa aattggtatt tagtttcagt ttacagtttc caatcgctat cccaaaagtc        60
     ccccacatgc tccccccccc cccccccccc cccccccccc tcacttcttg gccctgttgt       120
     tcccctgtac tgagcatata aagtttgcac gactaatggg cctctctttc cactgatgac       180
     caactaagcc attttctgat tcatatgcag ctagagacac gagctccagt ggggtactgg       240
     ttagttcata ttgttgttcc acctatagga ttgcagatcc ctttagctcc ttgggtactt       300
     tctctagctc ctccattgga ggccccgtgg tccatccaat agctgactgt gaacatccac       360
     ttctgtgttt gctaggcccc cgcatagtct cacaagagac agctctatct gggtcctttc       420
     agcaaaaatc ttgctagttg tgattctaat gccttacgtg cttctgtctt ggcagattct       480
     accaatgtgg ctttcaccat ctcgatgctt ctgggcaacc tcagcagctg ctgcaacccc       540
     tggatctata tgggcttcaa cagccacctg ttgccacgtt ccctgagtca ccgcgcctgc       600
     tgcaggggtt ccaagccccg agtgcacagg cagctctcca acagcagcct cgctagccgc       660
     cgcacaacac tgctgaccca cacctgtggt ccatctactc tccgtcttag ccttaacctc       720
     agcctccatg caaagcctaa gcctgcgggc tcgctgaagg atttggagca ggtggatgga       780
     gaagccacta tggagaccag catctcttag agaagagtcc ctggactctg gttctgtgca       840
     tctcaggcac tgggaatacg gactaggtgg ctcagggatg gtagaaagta gagcttagtt       900
     tgaggcaggg tgaggccaga gtagctggta ctactttgtc aaggcagggc ttagtgtggg       960
     tatggaccat tctctcttaa ttttagatag ctggaaatca ggaaactcaa cccccctgtt      1020
     cctgccaccc tgacaaagca ctcataagca tacccaactg gtagatatag tgttctagat      1080
     cgagtcgac                                                              1089
//


spacer
spacer