spacer

EBI Dbfetch

ID   AF098751; SV 1; linear; mRNA; STD; HUM; 396 BP.
XX
AC   AF098751;
XX
DT   06-MAR-2000 (Rel. 63, Created)
DT   26-MAY-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Homo sapiens APC1 protein mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-396
RA   Shao C., Yan W., Zhu F., Yue W., Chai Y., Zhao Z., Wang C.;
RT   ;
RL   Submitted (09-MAR-2000) to the INSDC.
RL   Urology, Xijing Hospital, No 17 Changle West Road, Xi'an, Shaanxi 710032,
RL   China
XX
DR   MD5; 1e05d15de10e0ae4e152a0fa100b6ba7.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   H-InvDB; HIT000068557_05.4.
DR   H-InvDB; HIT000068557_06.4.
DR   H-InvDB; HIT000068557_07.4.
DR   H-InvDB; HIT000068557_08.4.
DR   H-InvDB; HIT000068557_09.4.
DR   H-InvDB; HIT000068557_10.4.
DR   H-InvDB; HIT000068557_11.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..396
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_line="PC-3"
FT                   /tissue_type="prostate tumor"
FT                   /db_xref="taxon:9606"
FT   CDS             200..>396
FT                   /codon_start=1
FT                   /product="APC1 protein"
FT                   /note="cell apoptosis-related protein"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="H-InvDB:HIT000068557_04.4"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="AAF71992.1"
FT                   /translation="MCSSPTPSSRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEP
FT                   IYLGGVFQLEKGDRLSAEINR"
XX
SQ   Sequence 396 BP; 84 A; 135 C; 108 G; 69 T; 0 other;
     gcgtaaaccg taagcctgta gccccatgtt gtagcaaacc ctcaagctga ggggcagctc        60
     cagtggctga accgccgggc caatgccctc ctggccaatg gcgtggagct gagagataac       120
     cagctggtgg tgccatcaga gggcctgtac ctcatctact cccaggtcct cttcaagggc       180
     caaggctgcc cctccaccca tgtgctcctc acccacacca tccagccgca tcgccgtctc       240
     ctaccagacc aaggtcaacc tcctctctgc catcaagagc ccctgccaga gggagacccc       300
     agagggggct gaggccaagc cctggtatga gcccatctat ctgggagggg tcttccagct       360
     ggagaagggt gaccgactca gcgctgagat caatcg                                 396
//


spacer
spacer