Dbfetch

ID   AH007311; SV 2; linear; genomic DNA; STD; MUS; 6222 BP.
XX
AC   AH007311; AF097997-AF098009;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus fatty acid amide hydrolase gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6222
RX   DOI; 10.1006/geno.1998.5597.
RX   PUBMED; 9878243.
RA   Wan M., Cravatt B.F., Ring H.Z., Zhang X., Francke U.;
RT   "Conserved chromosomal location and genomic structure of human and mouse
RT   fatty-acid amide hydrolase genes and evaluation of clasper as a candidate
RT   neurological mutation";
RL   Genomics 54(3):408-414(1998).
XX
RN   [2]
RP   1-6222
RA   Wan M., Cravatt B.F., Francke U.;
RT   ;
RL   Submitted (09-OCT-1998) to the INSDC.
RL   Genetics, Stanford University, Beckman Center 203, Palo Alto, California
RL   94305, USA
XX
DR   MD5; e12728f113e26aa79002b1045cff8a71.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:4206731, gi:4206732, gi:4206733, gi:4206734, gi:4206735,
CC   gi:4206736, gi:4206737, gi:4206738, gi:4206739, gi:4206740,
CC   gi:4206741, gi:4206742, gi:4206743, gi:4206744.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6222
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<248..442,866..979,1247..1381,1536..1669,1764..1970,
FT                   2371..2411,2623..2747,3179..3304,3478..3575,3993..4092,
FT                   4464..4504,4803..4842,5135..5243,5463..5608,5910..>6038)
FT                   /product="fatty acid amide hydrolase"
FT   CDS             join(248..442,866..979,1247..1381,1536..1669,1764..1970,
FT                   2371..2411,2623..2747,3179..3304,3478..3575,3993..4092,
FT                   4464..4504,4803..4842,5135..5243,5463..5608,5910..6038)
FT                   /codon_start=1
FT                   /product="fatty acid amide hydrolase"
FT                   /protein_id="AAD11788.1"
FT                   /translation="MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRAR
FT                   QKQRAGLETMDKAVQRFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKA
FT                   WEVNKGTNCVTSYLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVT
FT                   SESDCVVVQVLKLQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEG
FT                   ALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVG
FT                   PMARDVDSLALCMKALLCEDLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTP
FT                   AMRRAVMETKQSLEAAGHTLVPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDP
FT                   CLGDLVLVLKLPRWFKKLLSFLLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSV
FT                   IAQWKAMNLDVVLTPMLGPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDD
FT                   AQMEHYKGYFGDMWDNILKKGMKKGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEK
FT                   RPS"
FT   exon            <248..442
FT                   /number=1
FT   gap             660..759
FT                   /estimated_length=unknown
FT   exon            866..979
FT                   /number=2
FT   gap             1043..1142
FT                   /estimated_length=unknown
FT   exon            1247..1381
FT                   /number=3
FT   exon            1536..1669
FT                   /number=4
FT   exon            1764..1970
FT                   /number=5
FT   gap             2093..2192
FT                   /estimated_length=unknown
FT   exon            2371..2411
FT                   /number=6
FT   gap             2460..2559
FT                   /estimated_length=unknown
FT   exon            2623..2747
FT                   /number=7
FT   gap             2783..2882
FT                   /estimated_length=unknown
FT   exon            3179..3304
FT                   /number=8
FT   gap             3352..3451
FT                   /estimated_length=unknown
FT   exon            3478..3575
FT                   /number=9
FT   gap             3754..3853
FT                   /estimated_length=unknown
FT   exon            3993..4092
FT                   /number=10
FT   gap             4273..4372
FT                   /estimated_length=unknown
FT   exon            4464..4504
FT                   /number=11
FT   gap             4536..4635
FT                   /estimated_length=unknown
FT   exon            4803..4842
FT                   /number=12
FT   gap             4893..4992
FT                   /estimated_length=unknown
FT   exon            5135..5243
FT                   /number=13
FT   gap             5332..5431
FT                   /estimated_length=unknown
FT   exon            5463..5608
FT                   /number=14
FT   gap             5666..5765
FT                   /estimated_length=unknown
FT   exon            5910..>6038
FT                   /number=15
XX
SQ   Sequence 6222 BP; 982 A; 1343 C; 1504 G; 1192 T; 1201 other;
     ctgttccgcc tgccttaaaa cgctggcacg ccaggaaccg ggccagaagg ggtctaggct        60
     tgaccttgac cgttggagct gctagcttgg ctctcgctgc cgggcaacgg cgcgctcccc       120
     gcgggcccgc ggctgcgcct gcccctccct caagcggaat cgcgggcgat ccaggccggg       180
     ttttgcagcg gagctgttgg tgtgcgcgtg ccgagtcctc tcgggtggcg gtcggctgca       240
     ggagatcatg gtgctgagcg aagtgtggac cgcgctgtct ggactctccg gggtttgcct       300
     agcctgcagc ttgctgtcgg cggcggtggt cctgcgatgg accaggagcc agaccgcccg       360
     gggcgcggtg accagggcgc ggcagaagca gcgagccggc ctggagacca tggacaaggc       420
     ggtgcagcgc ttccggctgc aggtgaaggc gggcgccggg gctggggtgg gctggcgtgg       480
     ggagcatggc gtgggcaagg ctgcgacttc aactgcccgg acgccagagg gccggctggc       540
     aggcagcgca gatgtgagcc ccggaacaga atcgccccct cctcgagcta atgcattccg       600
     tactctttct gcgccaggtg cagccaaagg gaagcggaaa agaaaaggac aggtggtggn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng gaagaaatgg gggggggggg       780
     taagattgga atgtaaagtg aataattaat ggaaaaaaga aaaaaaagtt gcacttgcta       840
     gattgacgta atgtgttacc cgcagaatcc tgacctggat tcagaggcct tgctggctct       900
     gcccctgctc caactggtac agaagttaca gagtggggaa ctgtccccag aagctgtgct       960
     ctttacctac ctgggaaagg taagccctaa gttagtcctg gttctttaca agctgagggg      1020
     aaaacctggc ctggaggttg gcnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nncggcctct gggccatgct tctggttacc ctttccctta caggaagtat agaaagagga      1200
     attttaaaaa gagaggaagc tggcttcctt gtatcccttt ccctaggcct gggaagtgaa      1260
     caaagggacc aactgtgtga cctcctatct gactgactgt gagactcagc tgtcccaggc      1320
     cccacggcag ggcctgctct atggcgtccc cgtgagcctc aaggaatgct tcagctacaa      1380
     ggtacaccct gcttgtcctg cctctgtgtc tgcatctagc tttgggtcca agatgccttg      1440
     gtggtctgtc cggccagtgt ggtagtggtg gtggtgggca tgccgctggg ctgttgaagg      1500
     gtcctgtggc attgtcgctg tcttctttct ctaagggcca tgcttccaca ctgggcttaa      1560
     gtttgaacga gggtgtgaca tcggagagtg actgtgtggt ggtgcaggta ctgaagctgc      1620
     agggagctgt gccctttgtg cacaccaacg tcccccagtc catgctaagg ttggtccccc      1680
     ggagctggtc taaccaatga ggtgggagca gacagaggca gttgatgagg tgacctgggc      1740
     tgaccttctc ctgcttcctc cagctatgac tgcagtaacc ccctctttgg ccagaccatg      1800
     aacccgtgga agccctccaa gagtccagga ggttcctcag ggggtgaggg ggctctcatt      1860
     ggatctggag gctcccctct gggtttaggc actgacatcg gcggcagcat ccggttccct      1920
     tctgccttct gtggcatctg tggcctcaag cctactggga accgcctcag gtacgttggg      1980
     gacagggagg gtcttgaaaa gacctaagga aagcacaacc ttggctcggc ctttctgctc      2040
     tctaggctgc aggagggatt cactaaccag cctttggtga gggtgtggga ggnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2160
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nntcttaggc tgcaggaggg attcactaac      2220
     cagcctttgg tgagggtgtg ggaggggatt agttacaacc agttatgcat ggtttcacgt      2280
     ccattgctgg gagtttagag ccatggctgg tcttgtggtg cgtatagggt agccagcgct      2340
     tgtttccaat atcttgtgtt tctgacccag caagagtggc ctgaagagct gtgtttatgg      2400
     acagacagca ggtgagtgag gtctatggta ctcttggtac cctgaagggt gtgtatgggn      2460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2520
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnna tccttactca gacctagggc      2580
     tcattgcggg ccaagtgaca cctctccctt cccttcctac agtgcagctt tctgttggcc      2640
     ccatggcacg ggatgtggat agcctggcat tgtgcatgaa agccctactt tgtgaggatt      2700
     tgttccgctt ggactccacc atccccccct tgcccttcag ggaggaggtg agtgaggata      2760
     ggaatgatct cattcaaccc cannnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2820
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2880
     nntaacagaa cctccactct gaagcagaat gcatagttgg gcnttctgcc tttggatagc      2940
     cctggtttcc tcttgtgact cctgggaatc ccctcattcc tgctaagttg ccaggaagac      3000
     attttgtgac agggtgctga tggtctgtgg ctcctacaac aatagttcag ggggaaagga      3060
     tgtcaggatt cagactgtaa ccttgtagct acggggggcc tggagcgtct cctcctctga      3120
     gcatcctgcg tgagtcattc tcttttgccc caaccccatt gcctacgttt gcttctagat      3180
     ctacagaagt tctcgacccc ttcgtgtggg atactatgaa actgacaact acaccatgcc      3240
     cactccagcc atgaggaggg ctgtgatgga gaccaagcag agtctcgagg ctgctggcca      3300
     cacggtatgg catctccttt ccctcagggg agtctcccat ggccagaccc tnnnnnnnnn      3360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nggccttacc cccttcaatc tccgcagctg      3480
     gtccccttct taccaaacaa cataccttat gccctggagg tcctgtcggc aggtgggctg      3540
     ttcagtgatg gtggctgctc ttttctccaa aacttgtgag tgtgatgggc ttgagggtca      3600
     agggtggaat ctgaacactg caggggggct gggctcagtg cagagcacgg gatgctcttc      3660
     cagatgatcc aggtttgatt cccagcaccc acatggcagc tcacagctga ctgttaaccc      3720
     agttccagaa gatctgatgc cctccctcgc tccnnnnnnn nnnnnnnnnn nnnnnnnnnn      3780
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3840
     nnnnnnnnnn nnnggaaaga tgccaaggaa gctatcagtg gagttgggca gggaaggagg      3900
     tggacagaac tgttgagtta cggggtttgc agtcctggag agtgaggagg ggcaggggag      3960
     ggggcatctt aactaagcct tttgtcttcc agcaaaggcg actttgtgga tccctgcttg      4020
     ggggacctgg tcttagtgct gaagctgccc aggtggttta aaaaactgct gagcttcctg      4080
     ctgaagcctc tggtgagagc accaggcatg caaggacatg gttgcaagga catggtcccc      4140
     gggcccccat ctcacactac cttgtggtct ctggctcttc cttcctccct tggtctctag      4200
     gtctgggcag gcatggtctc ttcatctctt ctaccctgac tgttctcctt tctacttttt      4260
     aacaaacctg ttnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nntaagggtc      4380
     atgacctgga cctggaaggt gggagggcga ggaggaggtg gcagaggtca ccagtcactg      4440
     accctgtgtc tgttctggtg cagtttcctc ggctggcagc ctttctcaac agtatgtgtc      4500
     ctcggtgaga acttcaatgc ctgcccctgt gtaccnnnnn nnnnnnnnnn nnnnnnnnnn      4560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4620
     nnnnnnnnnn nnnnntccct tgaaatcccg gatttttcca tctggagagc agggccttga      4680
     ttccctcaga gctcccctgg ggttgaatga gatcttgaag tgatggcagt aggatggatg      4740
     gtgttgctga tgctgatggc catggctgtg aaggctgacg accttcctct ctctctgctc      4800
     aggtcagccg aaaagctgtg ggaactgcag catgagattg aggtaaggtc tgggccctgg      4860
     agagcaggcg agggggcaat tgctcagggc atnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4980
     nnnnnnnnnn nngctctttt catctattgg tggctcagct acaacagatg caacagcaag      5040
     agctagggcg agagccacct cagtgtccat tggacatcag ggggtgcctt ggctctatcg      5100
     gagcacctcc cccaatgcgc ttgtgtctct gcagatgtat cgccagtccg tcattgccca      5160
     gtggaaggca atgaacttgg acgtggtgct aacccccatg ctgggtcctg ctctggattt      5220
     gaacacaccg ggcagagcca caggtgaggc ctattgcccc tctgctgatg ttctcatccc      5280
     ccgtcccctt ttgagttcag ccctgtgccc tgtggagcta tggggtagaa gnnnnnnnnn      5340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ncttgccaca gccagtgtgt tcttcccccc      5460
     aggggctatc agctacactg ttctctataa ctgcctggac ttccctgcgg gggtggtgcc      5520
     tgtcaccact gtgaccgctg aggacgatgc ccagatggaa cactacaaag gctactttgg      5580
     ggatatgtgg gacaacattc tgaagaaggt aaagcctgcc tgtcccccga gctctctgct      5640
     tcccaaaccc aactgctgta gagggnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5700
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5760
     nnnnntccta acactcacag gctgtgccat ccatctttaa cacaagcccc aggtctgctc      5820
     cttgctctcc ttggcagagc acaggtatcc tggacctatg gtgtggtctt acttcatttc      5880
     tctcatcctg atgtctgtat cccatgtagg gcatgaaaaa gggtataggc ctgcctgtgg      5940
     ctgtgcagtg cgtggctctg ccctggcagg aagagctgtg tctgcggttc atgcgggagg      6000
     tggaacggct gatgacccct gaaaagcggc catcttgagg gtcattcatc tgcccagctc      6060
     tggaggacct aaggcccatg cgctctgcac tgcagcccca tctattcagg atcctgccac      6120
     ccatgaggag atgcccagca cgggaagagg caaccacctg ccctcccctg gactcctaca      6180
     gaaacccagg acatgccctc cataaccaag tctggaccag ct                         6222
//