spacer

EBI Dbfetch

ID   AF097158; SV 1; linear; mRNA; STD; MUS; 4400 BP.
XX
AC   AF097158;
XX
DT   01-JUL-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus UDP-Gal:glucosylceramide beta-1,4-galactosyltransferase mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4400
RA   Takizawa M., Nomura T., Wakisaka E., Aoki J., Arai H., Inoue K., Matsuo N.;
RT   "cDNA cloning and expression of mouse lactosylceramide synthase";
RL   Unpublished.
XX
RN   [2]
RP   1-4400
RA   Takizawa M., Nomura T., Wakisaka E., Aoki J., Arai H., Inoue K.,
RA   Hattori M., Matsuo N.;
RT   ;
RL   Submitted (03-OCT-1998) to the INSDC.
RL   Biological Science Laboratories, Kao Corporation, 2606, Akabane,
RL   Ichikaimachi, Haga, Tochigi 321-3497, Japan
XX
DR   MD5; e13b605cee6f8d9291d8a54758158b89.
DR   Ensembl-Gn; ENSMUSG00000056124; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070080; mus_musculus.
DR   EuropePMC; PMC2064740; 17923531.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4400
FT                   /organism="Mus musculus"
FT                   /strain="C57Bl/6J"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             936..2084
FT                   /codon_start=1
FT                   /product="UDP-Gal:glucosylceramide
FT                   beta-1,4-galactosyltransferase"
FT                   /function="catalyzes the synthesis of lactosylceramide"
FT                   /note="glucosyltransferase"
FT                   /db_xref="GOA:Q9WVK5"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1928380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVK5"
FT                   /protein_id="AAD41694.1"
FT                   /translation="MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFM
FT                   VQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLP
FT                   HLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIGPGGHWRPKDCKPRWKVAVLIP
FT                   FRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWD
FT                   CVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKIN
FT                   GFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRY
FT                   SKERQYIDGLNNLLYTPKILVDRLYTNISVNLMPELAPIEDY"
XX
SQ   Sequence 4400 BP; 1055 A; 1109 C; 1030 G; 1206 T; 0 other;
     ggcgctccag gggctagggc tcttggttcc tcttctccgg gcgcaggccg cctggcgagt        60
     tgtggaccgg cgggcggagc ttgcaggggt ctcggggcgc acagggctgt cgggattgtc       120
     ctcgtgggtg tccgcggtcc gagatcgcct cgcgtctgtc atctttttcc ttcgccctcc       180
     gggccccggc cgtgcgcatc cgccgggtag tccggggtct gtgcgggggc ggcgccgcct       240
     ctccctcggg ctccgcggcg ggaatgcggc tgctgtggcc ggctgggcag cgggcggcgg       300
     cagcaagcgg aacccgggcg cactcgccgc tggccgggac gccgccctgg cctgcgctcc       360
     gctcccgagg ccgccgttgc gctccggggc ccggcgcgga atgaggtgca ggccgcgcga       420
     cggcgagcgc cccgctccgc ggcccccagg ttccccgcga ccgtccgtgc ctcgcgtgcc       480
     ccggtgccca ctttagagcc cccgcactag cagcgttcgc caaggcacag gcccgcagag       540
     cgcacgcgac ccggaccggg tcccgatcgc ggggactcgc ctcttggacg ccgccccgag       600
     tgcggggacc ccggcacgct gcagcgcgcg ggccgcactc cgcatcgccg agctccgcca       660
     gcctggcccg tggctttggc ctccaccgag cccggtctcc cggcctccct tcacgtttct       720
     ccgcatcctt ccaacaccct tcccgctgct ccaccgcctc ccattcattg catccgtttc       780
     tccttcccgg ctcggttctt ctccccacag cctccccggc cggaccccgc caccttcttg       840
     gggttctccg tacattcatg gaagtttagg gcctggaccg tggcccggag tctggcctga       900
     gagcgcagcc cgcgctactg gcagggcaga ggaagatgtc tgcgctcaag cggatgatgc       960
     gggtctccaa tcgctctctg attgccttca tcttcttctt ctccctctcc acgtcctgtc      1020
     tctacttcat ctatgtggct ccaggcatcg ccaacacgta cctctttatg gtacaagcta      1080
     gaggtatcat gctgagagag aatgtgaaaa caattggaca catgatcagg ctgtatacca      1140
     ataaaaacac tacgctcaac ggaacagatt atcctgaagg caataataca agtgactatc      1200
     ttgttcaaac aacaacgtat cttccgcaaa acttcacgta tttgccacac ctcccctgtc      1260
     cagagaagct gccttacatg cggggattcc tcagtgtcaa tgtgagtgag atcagttttg      1320
     atgaagtcca tcagctcttc tccaaggact cagagattgg gccaggaggc cactggaggc      1380
     ccaaagactg caagcccaga tggaaggtgg cagttctcat ccccttccgt aaccgccatg      1440
     aacatcttcc gatttttttc ctgcacctga ttccgatgct ccagaaacag cggctggaat      1500
     ttgcctttta tgtcatcgaa cagaccggca cacaaccatt caatcgtgcg atgctcttta      1560
     atgtgggttt caaagaggcc atgaaagaca gagcctggga ctgtgtgatc ttccatgatg      1620
     tggatcatct gcctgaaaat gatcggaact actacggatg tggagagatg ccgcggcact      1680
     ttgcagcgaa gctggacaag tacatgtaca ttcttcccta taaggagttt tttggtgggg      1740
     tgagtggcct gacggtggag caattcagga agatcaacgg ctttcccaat gccttctggg      1800
     gatggggagg cgaggacgat gacctttgga acagagttca ctacgccggc tacaatgtaa      1860
     cccggccaga aggggacttg ggaaaataca tatctattcc tcatcaccat cgaggggagg      1920
     tacagttcct aggacggtat aaattacttc ggtattccaa ggagcggcag tacatcgatg      1980
     gactgaacaa tttattatac acacccaaaa tactggttga taggctgtat acaaatatat      2040
     ctgtaaacct catgccagaa ttagctccaa ttgaagacta ttaaaagaag tcattctcat      2100
     ggtggggtag accacagtgc tggatcatga acttggcttg gagtgccctc accgtggaag      2160
     ttagagattg gggtgtatct cagtgtcccg gtctgtaaaa agagccagca atccttaatg      2220
     tttacagcgc gggctccatc cgtcacactc tcccactctc ccctgctggg agcgtccccc      2280
     catggcaagc actgtagaga taagaaccca ttgcttggga ctggaagtga agaaaactcc      2340
     ctacacagag aagattttta tactgaaatc tataatttaa ttcaagagaa tgcttttatt      2400
     tccgttcaaa catattttgt acatatgtga tgtaaattaa atgtgttcaa attgttggaa      2460
     aacaagatgt cacaattttg catgtaattg gttatgcctt cattggactt ttatagacat      2520
     ttttttattt gcatggggaa aaatgtaaat ttatgtcgcc aaacaaaggt taagccttgt      2580
     gtcaaatgaa gggactgtca gcgacagaca aagataatat agtaaccgtt ctgtactatt      2640
     ggtgttcagc tttagacctt cagcctcatg gcaggaggca cggtcctctg agggcttcga      2700
     aggaaggaag gactcgcata acttttcttc ctgccacgat tacctgtttt gttttgtcta      2760
     ttttttccct tgcttgcagt ctcatcagat cttgccaagt caacagccat attgtttatg      2820
     catactgcat gagtattacc aagaaaacct tcccagttgt aaagtgacgt gctgtacagg      2880
     acttcttcat gttaaatgtc tctatgtacc tccgcgtgtc agggatcttg tgcctcaaaa      2940
     aaacgttccc aaggttgtgt ttatacacgg ttgtgtttat acacggtata tatatttttt      3000
     tcaatctcat aatgaaaaca ttattattcc caccttagaa gaaccaaaag agggtatctt      3060
     cttttaaaaa cttttttttt ttgaaagaat gactttatgg aaaatccagt agtgcttata      3120
     cagatgaatt atactattag atgagagatt agatgctcta tttttatgaa gataaatgct      3180
     tagattaaaa caaacttcaa ctttaattct cagacataca tggttccctt tcacattagc      3240
     tcgtcactcc tactgctttt ttcactttta agaaatctct ggtgttatcc aatttttttt      3300
     tcactacaag tataatttaa tgcctaccac caccaccacc accccaccac caccaccatg      3360
     gtgctgggca gtgagccgag ggcctataga cttaccttac agtcattaat tgactgtgtg      3420
     gatattgtga cttctgctca ccctccacac acgggtgagg ttttcaatga ccagacaaca      3480
     acaaagccca aatagtgttc ttactttgaa aatgattgat tataaaaatt cttgaaaaat      3540
     agcctatatt cacatgtaag atcttatctc ccatctttaa acaaatttag aacaacatcg      3600
     tctgtcaagt aaaccctaag agtgagaatt ctggatgtga gaaagtttgc tccccttgtc      3660
     taatgttgag agcttagctt tcagttgtca ttgtctgtca tagttttggt aatgctgatg      3720
     accacaagtc aaaccctaca gtgataacta aaattcttgc accggagaag acagatgccc      3780
     tgttgtgaca gcaatctctc cgtgtttatt cttagaattg cttctaaaat atttacctcc      3840
     caaccttttt agctactcaa aaaagagtga aaaaaaaatc tcaacttctg gagatgaaga      3900
     tttttgtatg ttctcagttt atgttctgtc tcctgtggct aatgaagtgt ttaatttgac      3960
     cgaatgacag cagaatgtaa tgttaatgtt aaggcgggtg agacaggctc tttggcccct      4020
     ccttacagtg ctgtgggaag ctgtgccatg tggaatttta ttggaggaca cacacttcat      4080
     aatgtggcgg gctgtccaca gtggggtgcc ttttgcattg atacttagtt cacagtttta      4140
     ggaaaattca gaactggtca tctgccttac tttcttaggt taagtctagt attaatatgg      4200
     cttccggaat tggatgtaag taattttgct atatcttcgt gttgcatctg gaatgtcagc      4260
     ttgtgagaac caccttttct aattcagacc tggaattctt ttcagtaatg aatagtgacc      4320
     tgggtatgtt tccatggatg acagttttgc ctagttacca tgaccacgtg acaataaatc      4380
     tctttcttac atattagcac                                                  4400
//


spacer
spacer