spacer

EBI Dbfetch

ID   AF092929; SV 1; linear; mRNA; STD; MUS; 344 BP.
XX
AC   AF092929;
XX
DT   11-MAY-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus beta-defensin 3 (Bd3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-344
RX   PUBMED; 10377137.
RA   Bals R., Wang X., Meegalla R.L., Wattler S., Weiner D.J., Nehls M.C.,
RA   Wilson J.M.;
RT   "Mouse beta-defensin 3 is an inducible antimicrobial peptide expressed in
RT   the epithelia of multiple organs";
RL   Infect Immun 67(7):3542-3547(1999).
XX
RN   [2]
RP   1-344
RA   Bals R., Meegalla R., Wilson J.M.;
RT   ;
RL   Submitted (17-SEP-1998) to the INSDC.
RL   Institute for Human Gene Therapy, 3601 Spruce Street, Philadelphia, PA
RL   19104, USA
XX
DR   MD5; effd1201780b2ad69b4dbbed6f6d2db6.
DR   Ensembl-Gn; ENSMUSG00000039775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033852; mus_musculus.
DR   EuropePMC; PMC116542; 10377137.
DR   EuropePMC; PMC98207; 11254635.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..344
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /map="A4"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             10..201
FT                   /codon_start=1
FT                   /gene="Bd3"
FT                   /product="beta-defensin 3"
FT                   /note="antimicrobial peptide"
FT                   /db_xref="GOA:Q9WTL0"
FT                   /db_xref="InterPro:IPR001855"
FT                   /db_xref="InterPro:IPR006080"
FT                   /db_xref="MGI:MGI:1351612"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTL0"
FT                   /protein_id="AAD29572.1"
FT                   /translation="MRIHYLLFAFLLVLLSPPAAFSKKINNPVSCLRKGGRCWNRCIGN
FT                   TRQIGSCGVPFLKCCKRK"
XX
SQ   Sequence 344 BP; 126 A; 71 C; 63 G; 84 T; 0 other;
     gcttcagtca tgaggatcca ttaccttctc tttgcatttc tcctggtgct gctgtctcca        60
     cctgcagctt ttagcaaaaa aatcaacaat ccagtaagtt gtttgaggaa aggaggcaga       120
     tgctggaatc ggtgcattgg caacactcgt cagattggca gttgtggagt tcctttcctc       180
     aaatgctgca agagaaaata gagaagacca agatcccgtt aaacaaagaa aacaccagaa       240
     tttgctcctc catgaagatg gacaaatctt aaaccaaatt aatattcctt gattaaatgc       300
     aaacaagtgc tccctagcaa aaaaaaaaaa aaaaaaaaaa aaaa                        344
//


spacer
spacer