Dbfetch

ID   AF092050; SV 2; linear; mRNA; STD; MUS; 1260 BP.
XX
AC   AF092050;
XX
DT   28-JAN-1999 (Rel. 58, Created)
DT   10-AUG-2000 (Rel. 64, Last updated, Version 2)
XX
DE   Mus musculus beta-1,3-N-acetylglucosaminyltransferase mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1260
RX   DOI; 10.1073/pnas.96.2.406.
RX   PUBMED; 9892646.
RA   Zhou D., Dinter A., Gutierrez Gallego R., Kamerling J.P.,
RA   Vliegenthart J.F., Berger E.G., Hennet T.;
RT   "A beta-1,3-N-acetylglucosaminyltransferase with poly-N-acetyllactosamine
RT   synthase activity is structurally related to
RT   beta-1,3-galactosyltransferases";
RL   Proc. Natl. Acad. Sci. U.S.A. 96(2):406-411(1999).
XX
RN   [2]
RP   1-1260
RA   Zhou D., Berger E.G., Hennet T.;
RT   ;
RL   Submitted (15-SEP-1998) to the INSDC.
RL   Physiology, University of Zurich, Winterthurerstrasse 190, Zurich 8057,
RL   Switzerland
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1260
RA   Zhou D., Berger E.G., Hennet T.;
RT   ;
RL   Submitted (09-AUG-2000) to the INSDC.
RL   Physiology, University of Zurich, Winterthurerstrasse 190, Zurich 8057,
RL   Switzerland
XX
DR   MD5; c54ee6d162525671ea6c94cdef4d01cd.
DR   Ensembl-Gn; ENSMUSG00000051650; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018080; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018053; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018017; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018021; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017835; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018473; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017396; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017809; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017919; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017911; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017990; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018514; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017177; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017450; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000055549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062844; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0028226; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0028191; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0028155; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0028171; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027972; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028668; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027596; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027897; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0028025; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0028015; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0028138; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027997; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028702; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027481; mus_musculus_wsbeij.
DR   EuropePMC; PMC15149; 9892646.
XX
CC   On Aug 9, 2000 this sequence version replaced gi:4191391.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1260
FT                   /organism="Mus musculus"
FT                   /strain="ICR outbred"
FT                   /mol_type="mRNA"
FT                   /dev_stage="newborn"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             30..1223
FT                   /codon_start=1
FT                   /product="beta-1,3-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.149"
FT                   /note="glycosyltransferase; b3GnT"
FT                   /db_xref="GOA:Q9Z222"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1889505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z222"
FT                   /protein_id="AAD09763.2"
FT                   /translation="MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPK
FT                   EKFWKPPSTPRAYWNREQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMT
FT                   AVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRE
FT                   SWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSL
FT                   KEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGP
FT                   HSDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCL
FT                   QKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC"
XX
SQ   Sequence 1260 BP; 370 A; 282 C; 307 G; 301 T; 0 other;
     tggaggtgtc cctagacaag gtatgagaga tgagtgtggg gcgtcgaaga gtcaagttgc        60
     tgggcatcct gatgatggca aatgtcttca tttatttgat tgtggaagtc tccaaaaaca       120
     gtagccaaga caaaaatgga aagggaggag taataatccc gaaagagaag ttctggaagc       180
     cacccagcac tccccgggca tactggaaca gggaacagga gaagctgaac aggtggtaca       240
     atcccatctt gaacagggtg gccaatcaga caggggagct agccacatct ccaaacacaa       300
     gtcacctgag ctattgtgaa ccagactcga cggtcatgac agctgtgaca gattttaata       360
     atctgccgga cagatttaaa gactttctct tgtatttgag atgccggaat tactcgctgc       420
     ttatagatca accgaagaaa tgtgcaaaga agcccttctt actattggcg ataaagtccc       480
     tcattccaca ttttgccaga aggcaagcaa ttcgggagtc ttggggccga gaaaccaacg       540
     tagggaacca gacagtagtg agggtcttcc tgttgggcaa gacaccccca gaggacaacc       600
     accctgacct ttcggacatg cttaagtttg agagtgacaa gcaccaggac atcctcatgt       660
     ggaactatag agacacattc ttcaacctgt ccctgaagga agtgctgttt cttaggtggg       720
     tgagcacttc ctgtccagac gcagagtttg tcttcaaggg cgatgatgac gtgtttgtga       780
     acacccatca catccttaat tacttgaata gcttatccaa gagcaaagcc aaagacttgt       840
     tcataggtga cgtgatccac aatgctgggc ctcactcgga taagaaactg aagtactaca       900
     tcccagaagt cttctacacc ggcgtctacc caccgtatgc cgggggtggt ggattcctgt       960
     actccggccc ccttgccttg aggctgtaca gtgcgactag ccgggtccat ctctacccta      1020
     ttgatgatgt ttatacggga atgtgccttc agaaactggg ccttgttcca gagaagcaca      1080
     aaggcttcag gacatttgat attgaagaga aaaataagaa aaatatttgt tcctatatag      1140
     acctaatgtt agtacatagc agaaaacctc aagagatgat tgatatctgg tctcagttgc      1200
     aaagtcctaa tttaaaatgc tgaaatagac atgagctgca tttcacagaa aggcctagcc      1260
//