Dbfetch

ID   AF090373; SV 1; linear; mRNA; STD; MUS; 284 BP.
XX
AC   AF090373;
XX
DT   23-SEP-1998 (Rel. 57, Created)
DT   23-SEP-1998 (Rel. 57, Last updated, Version 1)
XX
DE   Mus musculus GABA-A receptor alpha-4 subunit mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-284
RA   Gustincich S., Feigenspan A., Sieghart W., Raviola E.;
RT   "GABAA receptors of dopaminergic cells of the mouse retina";
RL   Unpublished.
XX
RN   [2]
RP   1-284
RA   Gustincich S., Feigenspan A., Raviola E.;
RT   ;
RL   Submitted (04-SEP-1998) to the INSDC.
RL   Neurobiology, Harvard Medical School, 220 Longwood Avenue, Boston, MA
RL   02115, USA
XX
DR   MD5; 6eac828b8712d7f65059424261b0ce5f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..284
FT                   /organism="Mus musculus"
FT                   /strain="C57Bl/6J"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>284
FT                   /codon_start=2
FT                   /product="GABA-A receptor alpha-4 subunit"
FT                   /db_xref="GOA:O88963"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="MGI:MGI:95616"
FT                   /db_xref="UniProtKB/TrEMBL:O88963"
FT                   /protein_id="AAC35560.1"
FT                   /translation="EVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEIL
FT                   RLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRL"
XX
SQ   Sequence 284 BP; 99 A; 49 C; 56 G; 80 T; 0 other;
     agaagtgaaa actgatatat atgtcaccag ctttgggccc gtttctgatg ttgaaatgga        60
     atacactatg gatgtgttct tcagacagac atggattgac aaaagactaa aatatgacgg       120
     cccaattgaa atcttgaggc tgaataatat gatggtcacc aaagtttgga cccctgatac       180
     tttcttcagg aatggaaaga aatctgtctc acataacatg acagctccaa ataagctttt       240
     tagaattatg agaaatggca ctattttata cacaatgaga ctca                        284
//