spacer

EBI Dbfetch

ID   AF089723; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF089723;
XX
DT   25-AUG-1999 (Rel. 60, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (DRB1) gene, DRB1*0106 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.1999.530313.x.
RX   PUBMED; 10203026.
RA   Palou E., Mongay L., Arias M.T., Isart F., Suarez B., Masso M.,
RA   Fabregat V., Martorell J., Gaya A.;
RT   "Identification of a novel DRB1-allele (DRB1*0106) by sequence-based
RT   typing";
RL   Tissue Antigens 53(3):308-310(1999).
XX
RN   [2]
RP   1-270
RA   Gaya A., Arias M.T., Isart F., Suarez B., Masso M., Fabregat V.,
RA   Martorell J.;
RT   ;
RL   Submitted (01-SEP-1998) to the INSDC.
RL   Servei d'Immunologia, Hospital Clinic, Villarroel 170, Barcelona 08036,
RL   Spain
XX
DR   MD5; 754031fa555d3c0e6265902702d3bad7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            1..270
FT                   /gene="DRB1"
FT                   /number=2
FT   mRNA            <1..>270
FT                   /gene="DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04229"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*01:06"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1AQD"
FT                   /db_xref="PDB:1DLH"
FT                   /db_xref="PDB:1FYT"
FT                   /db_xref="PDB:1HXY"
FT                   /db_xref="PDB:1JWM"
FT                   /db_xref="PDB:1JWS"
FT                   /db_xref="PDB:1JWU"
FT                   /db_xref="PDB:1KG0"
FT                   /db_xref="PDB:1KLG"
FT                   /db_xref="PDB:1KLU"
FT                   /db_xref="PDB:1LO5"
FT                   /db_xref="PDB:1PYW"
FT                   /db_xref="PDB:1R5I"
FT                   /db_xref="PDB:1SEB"
FT                   /db_xref="PDB:1SJE"
FT                   /db_xref="PDB:1SJH"
FT                   /db_xref="PDB:1T5W"
FT                   /db_xref="PDB:1T5X"
FT                   /db_xref="PDB:2FSE"
FT                   /db_xref="PDB:2G9H"
FT                   /db_xref="PDB:2IAM"
FT                   /db_xref="PDB:2IAN"
FT                   /db_xref="PDB:2ICW"
FT                   /db_xref="PDB:2IPK"
FT                   /db_xref="PDB:2OJE"
FT                   /db_xref="PDB:2XN9"
FT                   /db_xref="PDB:3L6F"
FT                   /db_xref="PDB:3PDO"
FT                   /db_xref="PDB:3PGC"
FT                   /db_xref="PDB:3PGD"
FT                   /db_xref="PDB:3QXA"
FT                   /db_xref="PDB:3QXD"
FT                   /db_xref="PDB:3S4S"
FT                   /db_xref="PDB:3S5L"
FT                   /db_xref="PDB:4AEN"
FT                   /db_xref="PDB:4AH2"
FT                   /db_xref="PDB:4C56"
FT                   /db_xref="PDB:4E41"
FT                   /db_xref="PDB:4FQX"
FT                   /db_xref="PDB:4GBX"
FT                   /db_xref="PDB:4I5B"
FT                   /db_xref="PDB:4OV5"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04229"
FT                   /protein_id="AAD51131.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQARAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 57 A; 63 C; 99 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer