spacer

EBI Dbfetch

ID   AF088850; SV 1; linear; genomic DNA; STD; MUS; 1776 BP.
XX
AC   AF088850;
XX
DT   27-APR-1999 (Rel. 59, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus frizzled-9 (Fzd9) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1776
RX   DOI; 10.1006/geno.1999.5773.
RX   PUBMED; 10198163.
RA   Wang Y.K., Sporle R., Paperna T., Schughart K., Francke U.;
RT   "Characterization and expression pattern of the frizzled gene Fzd9, the
RT   mouse homolog of FZD9 which is deleted in Williams-Beuren syndrome";
RL   Genomics 57(2):235-248(1999).
XX
RN   [2]
RP   1-1776
RA   Wang Y.-K., Francke U.;
RT   ;
RL   Submitted (29-AUG-1998) to the INSDC.
RL   Howard Hughes Medical Institute, Stanford Medical Center, B201 Beckman
RL   Center, Stanford, CA 94305, USA
XX
DR   MD5; f74a7ca76573cccb580434d355914fbb.
DR   Ensembl-Gn; ENSMUSG00000049551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062572; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1776
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /map="between Gtf2i/Limk and Zp3"
FT                   /strain="129"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>1776
FT                   /gene="Fzd9"
FT                   /product="frizzled"
FT   CDS             1..>1776
FT                   /codon_start=1
FT                   /gene="Fzd9"
FT                   /product="frizzled-9"
FT                   /note="potential receptor of Wnt; human homolog deleted in
FT                   Williams-Beuren Syndrome"
FT                   /db_xref="GOA:Q9R216"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:1313278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R216"
FT                   /protein_id="AAD27789.1"
FT                   /translation="MAVPPLLRGALLLWQLLATGGAALEIGRFDPERGRGPAPCQAMEI
FT                   PMCRGIGYNLTRMPNLLGHTSQGEAAAQLAEFSPLVQYGCHSHLRFFLCSLYAPMCTDQ
FT                   VSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAG
FT                   PTEPHKGLGMLPVAPRPARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEV
FT                   FWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLA
FT                   FLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWF
FT                   LAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAAL
FT                   TGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTV
FT                   PATCVIVCYVYERLNMDFWRLRATEQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFM
FT                   SLVVGITSGVWVWSSKTFQTWQSLCYRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVV
FT                   LHMTKTDPSLENPTHL"
XX
SQ   Sequence 1776 BP; 310 A; 575 C; 523 G; 368 T; 0 other;
     atggccgtgc caccgctgct ccgcggggcg ctgctgctgt ggcagctgct ggcgacgggc        60
     ggcgcggcgc tggagatcgg ccgcttcgat ccggagcgtg gccgtggccc cgcaccgtgc       120
     caagcgatgg agatccccat gtgccggggc attggctaca acctgacccg catgcccaac       180
     ctactgggcc acacgtcgca gggcgaggcg gcggcgcagc tggccgagtt ctcgcccctc       240
     gtgcagtacg gctgccacag ccacctgcgc ttcttcctct gctcgctcta cgccccaatg       300
     tgcaccgacc aggtctccac tcccatccca gcctgccggc ccatgtgcga gcaggctcgc       360
     ctgcgctgcg cccccatcat ggagcaattc aatttcggct ggcccgactc actcgactgt       420
     gcccggctcc ccacgcgcaa cgacccgcac gcactctgta tggaggcacc cgagaacgct       480
     acagcaggcc ccacagaacc ccacaagggc ctgggcatgc tccctgtggc acctcggccc       540
     gcgaggccac cgggagattc agccccaggt cccggcagcg gtggcacctg cgacaacccc       600
     gagaagttcc agtacgtgga gaagagtcgc tcgtgcgctc cgcgctgcgg gccaggcgtc       660
     gaggtgttct ggtctcggcg cgataaggac ttcgcgctgg tttggatggc tgtgtggtcc       720
     gcgttgtgtt tcttctccac ggccttcacc gtgttcacct tcctgctgga gcctcaccgg       780
     ttccagtacc cagagcgccc gattatcttc ctttctatgt gctacaatgt ctactccttg       840
     gccttcctga tcagagcggt ggcaggtgca cagagtgtgg catgcgacca ggaggcaggg       900
     gctctgtatg tgatccagga gggtctggaa aacacaggct gcaccctggt cttcctgttg       960
     ctctattatt tcgggatggc cagctcactt tggtgggtgg ttttgactct aacctggttc      1020
     ctggctgcag gcaaaaaatg gggccacgag gccatcgagg ctcacggcag ctacttccac      1080
     atggcagcgt ggggcctgcc agcactcaaa actatcgtgg tcctgactct gcgcaaggtg      1140
     gctggcgatg aactgactgg gctctgctat gtagccagca tggacccggc agccctcact      1200
     ggctttgtgt tggtacccct atcttgctac ctggtactgg gtaccagttt cctcctgacc      1260
     ggttttgtgg ctctcttcca tatccgcaaa atcatgaaga cgggaggcac caatacggag      1320
     aagctggaga agctgatggt caaaatcgga gtcttttcca tcctttacac agtgccggcc      1380
     acctgcgtca ttgtctgcta cgtttatgaa cgcctcaaca tggacttctg gcggcttcgg      1440
     gccacagagc aaccatgtac tgctgccacc gtgcctggag gccggagaga ctgctcgctg      1500
     ccagggggct cggtgcccac tgtggctgtc ttcatgctca aaatcttcat gtccttggtg      1560
     gtgggcatca ccagtggagt ctgggtatgg agttccaaga cttttcagac ttggcagagc      1620
     ctgtgctacc gaaaaatggc agctggccga gcccgggcca aggcctgccg aaccccaggg      1680
     ggctatggcc ggggtaccca ctgccactac aaagccccca cggtggtctt gcacatgact      1740
     aagacagacc cctctctgga gaaccccaca cacctc                                1776
//


spacer
spacer