spacer

EBI Dbfetch

ID   AF086625; SV 1; linear; mRNA; STD; MUS; 1940 BP.
XX
AC   AF086625;
XX
DT   27-OCT-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus phosphoinositide-dependent protein kinase PDK1 mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1940
RX   DOI; 10.1074/jbc.274.12.8117.
RX   PUBMED; 10075713.
RA   Dong L.Q., Zhang R.B., Langlais P., He H., Clark M., Zhu L., Liu F.;
RT   "Primary structure, tissue distribution, and expression of mouse
RT   phosphoinositide-dependent protein kinase-1, a protein kinase that
RT   phosphorylates and activates protein kinase Czeta";
RL   J Biol Chem 274(12):8117-8122(1999).
XX
RN   [2]
RP   1-1940
RA   Liu F.;
RT   ;
RL   Submitted (23-AUG-1998) to the INSDC.
RL   Pharmacology, UTHSCSA, 7703 Floyd Curl Drive, San Antonio, TX 78284, USA
XX
DR   MD5; 50dddf8cb2677de01e1c45a3e36fa0da.
DR   Ensembl-Gn; ENSMUSG00000024122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102927; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1940
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             101..1780
FT                   /codon_start=1
FT                   /product="phosphoinositide-dependent protein kinase PDK1"
FT                   /db_xref="GOA:Q9Z2A0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2A0"
FT                   /protein_id="AAC67544.1"
FT                   /translation="MARTTSQLYDAVPIQSSVVLCSCPXPSMVRSQTEPGSSPGIPSGV
FT                   SRQGSTMDGTTAEARPSTNPLQQHPAQLPPQPRKKRPENFKFGKILGEGSFSTVVLARE
FT                   LATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLS
FT                   YAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHI
FT                   QITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAG
FT                   LPPFRAGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLK
FT                   AHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHS
FT                   LSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENN
FT                   LILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTF
FT                   FVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQQYQSNPDAAVQ"
XX
SQ   Sequence 1940 BP; 547 A; 478 C; 464 G; 450 T; 1 other;
     ggcgcgagat tgctggggct cctccgcggg gatgaggacg ctgaggaggc gccgagcagc        60
     gcaacgctgc gggggaggcg cccgcgccga cttggggctc atggccagga ccaccagcca       120
     gctgtatgac gctgtgccca ttcagtccag tgtggtgcta tgttcctgcc canccccatc       180
     aatggtgagg tcccaaactg agcccggttc gtcccctggc attcctagtg gtgttagcag       240
     gcagggatcc accatggatg gcaccacagc tgaagcccga ccaagcacca accccttgca       300
     gcagcaccct gcccagctgc caccacagcc tcgcaagaaa cgccctgaaa acttcaagtt       360
     tgggaaaatt cttggcgaag gctctttttc aacagttgtt ctggcccgag aactggccac       420
     ttccagagaa tatgctatta aaattctgga gaaacgtcat attataaaag aaaacaaagt       480
     tccgtatgta actagagaga gagatgtgat gtcacgcctg gatcacccct tctttgtgaa       540
     actttatttt acatttcagg acgacgaaaa gctgtatttt ggccttagtt atgccaaaaa       600
     tggagagcta cttaaataca tccgcaaaat tggctcattt gatgagacct gtacccggtt       660
     ttacacggct gagattgtgt ctgctttaga gtacttgcat ggcaagggca tcattcacag       720
     agaccttaaa ccagaaaaca ttttgttaaa tgaagacatg cacatccaga tcacagattt       780
     tggaacagca aaagtgttat ccccagagag caaacaagcc agggccaact catttgtagg       840
     aacagcacag tatgtttctc cagagctgct cacagagaag tcggcgtgta aaagttcaga       900
     cctttgggcc cttggatgta taatctatca gctcgtggca ggactcccac cattcagagc       960
     cgggaatgaa tatcttatat ttcagaagat cattaagctg gaatatcatt tcccagaaaa      1020
     attcttccct aaggctagag atcttgtgga aaaactcttg gttttagatg ccacaaagcg      1080
     tttaggctgt gaagagatgg aagggtacgg gcctctcaaa gctcatccat tctttgagac      1140
     catcacttgg gagaatttgc accagcagac acctccgaag ctcacagctt acctaccagc      1200
     catgtcagag gatgatgaag actgctatgg caactacgac aatctcctga gccagtttgg      1260
     cttcatgcag gtgtcatcct cctcctcttc ccactccctg tctacggtgg aaaccagcct      1320
     gccccagagg tcgggcagca acatagagca gtacatccat gatttggaca ctaactcttt      1380
     tgaactagac ttacagtttt cagaagatga aaaaaggttg ttattggaaa agcaagccgg      1440
     tggaaaccct tggcaccagt ttgtagaaaa taatctaata ttaaaaatgg gtccagtgga      1500
     taagcgaaag ggtttatttg caagacgacg acagttatta ctcacagaag ggccacattt      1560
     atattatgtt gatcctgtca acaaggtctt gaaaggtgaa atcccatggt cacaagaact      1620
     ccgaccagaa gccaagaatt ttaaaacttt ctttgtccac acgcctaaca ggacgtacta      1680
     cctgatggat ccaagcggga atgctcacaa gtggtgcaga aagatccagg aggtttggag      1740
     gcagcagtac cagagcaatc cagatgctgc tgtgcagtga cgtggcctgc ggccgggctg      1800
     cctattgctg ccaggatacc tgccccagcg cggctcggcc gccacccagg acgcttccag      1860
     accacctgcc agccatctcg tggagaacat agatggcaga aatcttgcag cttttttatt      1920
     taaaaaaaaa aaaaaaaaaa                                                  1940
//


spacer
spacer