Dbfetch

ID   AF083067; SV 2; linear; mRNA; STD; MUS; 750 BP.
XX
AC   AF083067;
XX
DT   29-MAR-1999 (Rel. 59, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus neuregulin-4 short isoform (Nrg4) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-750
RX   DOI; 10.1038/sj.onc.1202631.
RX   PUBMED; 10348342.
RA   Harari D., Tzahar E., Romano J., Shelly M., Pierce J.H., Andrews G.C.,
RA   Yarden Y.;
RT   "Neuregulin-4: a novel growth factor that acts through the ErbB-4 receptor
RT   tyrosine kinase";
RL   Oncogene 18(17):2681-2689(1999).
XX
RN   [2]
RP   1-750
RA   Harari D., Yarden Y.;
RT   ;
RL   Submitted (09-AUG-1998) to the INSDC.
RL   Biological Regulation, The Weizmann Institute of Science, Rehovot 76100,
RL   Israel
XX
DR   MD5; 1a68ec2389762840c33c8d7b16982850.
DR   Ensembl-Gn; ENSMUSG00000032311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164721; mus_musculus.
XX
CC   On Mar 30, 1999 this sequence version replaced gi:4530129.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..750
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             64..411
FT                   /codon_start=1
FT                   /gene="Nrg4"
FT                   /product="neuregulin-4 short isoform"
FT                   /note="ErbB-4 ligand"
FT                   /db_xref="GOA:Q9WTX4"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="MGI:MGI:1933833"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTX4"
FT                   /protein_id="AAD21874.1"
FT                   /translation="MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRCIENYTGARC
FT                   EEVFLPSSSIPSESNLSAAFVVLAVLLTLTIAALCFLCRKGHLQRASSVQCEISLVETN
FT                   NTRTRHSHREH"
XX
SQ   Sequence 750 BP; 209 A; 191 C; 164 G; 186 T; 0 other;
     tgttgaggtg ctgattttca accttaattc ttccatcaag aatgaaacta tttaaaaatt        60
     aagatgccaa cagatcacga gcagccctgt ggtcccaggc acaggtcatt ttgcctcaat       120
     ggggggattt gttatgtgat ccctactatc cccagcccat tctgtaggtg cattgaaaat       180
     tacaccggag cacgctgcga agaggttttt ctcccaagct ccagcatccc aagcgaaagt       240
     aatctgtcgg cagctttcgt ggtgctggcg gtcctcctca ctcttaccat cgcggcgctc       300
     tgcttcctgt gcaggaaggg ccaccttcag agggccagtt cagtccagtg tgagatcagc       360
     ctggtagaga caaacaatac cagaacccgt cacagccaca gagaacactg aagacataca       420
     tccccagtga agggcatcat tacctacaaa ggcggactgt ggaccatacg acgagagaag       480
     cccatcatca tggatgtgtc ccatcatttc tatggcagtc ccaggatctc actcttcttg       540
     atgctctact gtttgattgt tcatcgttca catacagaaa tgacgctggt ttcctgtgtt       600
     gaccttgcac cctgctactg tcatcactgg cctggaagtc agcagtatag ataaggctgg       660
     ccctgaattc aagagactca cctgtttttg cctactcaga gttactggaa ttaaaggcat       720
     aacaacaaaa aaaaaaaaaa aaaaaaaaga                                        750
//