Dbfetch

ID   AF079535; SV 1; linear; mRNA; STD; MUS; 1923 BP.
XX
AC   AF079535;
XX
DT   18-DEC-1998 (Rel. 58, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus 3-phosphoinositide dependent protein kinase-1 mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1923
RA   Xu P., Taylor S.;
RT   ;
RL   Submitted (22-JUL-1998) to the INSDC.
RL   Diabetes Branch, NIDDK, NIH, Bldg. 10, Rm. 8D20, 10 Center Dr., Bethesda,
RL   MD 20892, USA
XX
DR   MD5; 6c43b24073a3c784983d817d7e70dfe3.
DR   Ensembl-Gn; ENSMUSG00000024122; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023288; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023248; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023215; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023253; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023013; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023696; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0022515; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022989; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023088; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023195; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023107; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023734; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022264; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0022578; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000102927; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0045881; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0045859; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0045812; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0045824; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0045556; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046309; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0045662; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0045487; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0045609; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0045577; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0045711; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0045551; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0046392; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045247; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0044932; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1923
FT                   /organism="Mus musculus"
FT                   /strain="C57BL"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             92..1771
FT                   /codon_start=1
FT                   /product="3-phosphoinositide dependent protein kinase-1"
FT                   /note="protein kinase B kinase"
FT                   /db_xref="GOA:Q9Z2A0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR033931"
FT                   /db_xref="MGI:MGI:1338068"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2A0"
FT                   /protein_id="AAC96115.1"
FT                   /translation="MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGV
FT                   SRQGSTMDGTTAEARPSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARE
FT                   LATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLS
FT                   YAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHI
FT                   QITDFGTAKVLSPESKQARANSFVGPAQYVSPELLTEKSACKSSDLWALGCIIYQLVAG
FT                   LPPSRAGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLK
FT                   AHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHS
FT                   LSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENN
FT                   LILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTF
FT                   FVHTPNRTYYLMDPSGNAHKWCRKIQEVRRQQYQSNPDAAVQ"
XX
SQ   Sequence 1923 BP; 533 A; 479 C; 464 G; 447 T; 0 other;
     ttgctggggc tccgccgcgg ggaggaggac gctgaggagg cgccgagcag cgcaacgctg        60
     cgggggaggc gcccgcgccg acttggggct catggccagg accaccagcc agctgtatga       120
     cgctgtgccc attcagtcca gtgtggtgct atgttcctgc ccatccccat caatggtgag       180
     gtcccagact gagcccggtt cgtcccctgg cattcctagt ggtgttagca ggcagggatc       240
     caccatggat ggcaccacag ctgaagcccg accaagcacc aaccccttgc agcagcaccc       300
     tgcccagctg ccaccacagc ctcgcaagaa acgccctgaa gacttcaagt ttgggaaaat       360
     tcttggcgag ggctcttttt caacagttgt tctggcccga gaactggcca cttccagaga       420
     atatgctatt aaaattctgg agaaacgtca tattataaaa gaaaacaaag ttccgtatgt       480
     aactagagag agagatgtga tgtcacgcct ggatcacccc ttctttgtga aactttattt       540
     tacatttcag gacgacgaaa agctgtattt tggccttagt tatgccaaaa atggagagct       600
     acttaaatac atccgcaaaa ttggctcatt tgatgagacc tgtacccggt tttacacggc       660
     tgagattgtg tctgctttag agtacttgca tggcaagggc atcattcaca gagaccttaa       720
     accagaaaac attttgttaa atgaagacat gcacatccag atcacagatt ttggaacagc       780
     aaaagtgtta tccccagaga gcaaacaagc cagggccaac tcatttgtag gaccagcaca       840
     gtatgtttct ccagagctgc tcacagagaa gtcggcgtgt aaaagttcag acctttgggc       900
     ccttggatgt ataatctatc agctcgtggc aggactccca ccatccagag ccgggaatga       960
     atatcttata tttcagaaga tcattaagct ggaatatcat ttcccagaaa aattcttccc      1020
     taaggctaga gatcttgtgg aaaaactctt ggttttagat gccacaaagc gtttaggctg      1080
     tgaagagatg gaagggtacg ggcctctcaa agctcatcca ttctttgaga ccatcacttg      1140
     ggagaatttg caccagcaga cacctccgaa gctcacagct tacctaccag ccatgtcaga      1200
     ggatgatgaa gactgctatg gcaactacga caatctcctg agccagtttg gcttcatgca      1260
     ggtgtcatcc tcctcctctt cccactccct gtctacggtg gaaaccagcc tgccccagag      1320
     gtcgggcagc aacatagagc agtacatcca tgatttggac actaactctt ttgaactaga      1380
     cttacagttt tcagaagatg aaaaaaggtt gttattggaa aagcaagccg gtggaaaccc      1440
     ttggcaccag tttgtagaaa ataatctaat attaaaaatg ggtccagtgg ataagcgaaa      1500
     gggtttattt gcaagacgac gacagttatt actcacagaa gggccacatt tatattatgt      1560
     tgatcctgtc aacaaggtct tgaaaggtga aatcccatgg tcacaagaac tccgaccaga      1620
     agccaagaat tttaaaactt tctttgtcca cacgcctaac aggacgtact acctgatgga      1680
     tccaagcggg aatgctcaca agtggtgcag aaagatccag gaggttcgga ggcagcagta      1740
     ccagagcaat ccagatgctg ctgtgcagtg acgtggcctg cggccgggct gcctattgct      1800
     gccaggatac ctgccccagc gcggctcggc cgccacccag gacgcttcca gaccacctgc      1860
     cagccatctc gtggagaaca tagatggcag aaatcttgca gcttttttat ttaaaaaaaa      1920
     aaa                                                                    1923
//