Dbfetch

ID   AF077847; SV 1; linear; mRNA; STD; MUS; 5043 BP.
XX
AC   AF077847;
XX
DT   04-NOV-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus LDL receptor member LR3 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5043
RX   DOI; 10.1006/geno.1998.5688.
RX   PUBMED; 10049586.
RA   Chen D., Lathrop W., Dong Y.;
RT   "Molecular cloning of mouse Lrp7(Lr3) cDNA and chromosomal mapping of
RT   orthologous genes in mouse and human";
RL   Genomics 55(3):314-321(1999).
XX
RN   [2]
RP   1-5043
RA   Chen D., Lathrop W., Dong Y.;
RT   ;
RL   Submitted (14-JUL-1998) to the INSDC.
RL   Bayer Pharmaceuticals, 400 Morgan Lane, West Haven, CT 06516, USA
XX
DR   MD5; 2465d043f304145da00030c3b4d8c9ea.
DR   Ensembl-Gn; ENSMUSG00000024913; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024627; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024594; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024565; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024592; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024361; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025040; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023833; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_DBA2J_G0024460; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024427; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024546; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024457; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025088; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023579; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023896; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025856; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050297; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050277; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050235; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050229; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049972; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050723; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050099; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_DBA2J_T0050000; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049971; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050129; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049971; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050837; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049701; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049270; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5043
FT                   /organism="Mus musculus"
FT                   /chromosome="19"
FT                   /map="19B"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             1..4845
FT                   /codon_start=1
FT                   /product="LDL receptor member LR3"
FT                   /db_xref="GOA:Q91VN0"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017049"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="MGI:MGI:1278315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VN0"
FT                   /protein_id="AAC70183.1"
FT                   /translation="METAPTRAPPPPPPPLLLLVLYCSLVPAAASPLLLFANRRDVRLV
FT                   DAGGVKLESTIVASGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQNIVIS
FT                   GLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGY
FT                   MYWTDWGEAPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHHAN
FT                   LDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSPM
FT                   DIQVLSQERQPPFHTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKTGAE
FT                   EVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRA
FT                   YLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLD
FT                   EPRAIVLHPVMGLMYWTDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLY
FT                   WGDAKTDKIEVINIDGTKRKTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKAS
FT                   RDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCFFTPRATKCGCPIGLELLSD
FT                   MKTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVS
FT                   LKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQV
FT                   LVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDY
FT                   ADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERAD
FT                   KTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPGGHRCGCASH
FT                   YTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGLRNVKAINYDPLDKF
FT                   IYWVDGRQNIKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLFWTCEATNTIN
FT                   VHRLDGDAMGVVLRGDRDKPRAIAVNAERGYMYFTNMQDHAAKIERASLDGTEREVLFT
FT                   TGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHL
FT                   YWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEFSAHPCARDNGGCSH
FT                   ICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACTTGEIDCIPGAWRCDGFPE
FT                   CADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQDRSDEANCDAVCLPNQFRCT
FT                   SGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIPAHSSAIGPVIGIILSLFVMGGV
FT                   YFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFIAPGGSQHGPFPGIPCSKSVMSSMS
FT                   LVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDVFYSSGI
FT                   PATARPYRPYVIRGMAPPTTPCSTDVCDSDYSISRWKSSKYYLDLNSDSDPYPPPPTPH
FT                   SQYLSAEDSCPPSPGTERSYCHLFPPPPSPCTDSS"
XX
SQ   Sequence 5043 BP; 1103 A; 1504 C; 1421 G; 1015 T; 0 other;
     atggaaacgg cgccgacccg ggcccctccg ccgccgccgc cgccgctgct gctgctggtg        60
     ctgtactgca gcttggtccc cgccgcggcc tcaccgctcc tgttgtttgc caaccgccgg       120
     gatgtgcggc tagtggatgc cggcggagtg aagctggagt ccaccattgt ggccagtggc       180
     ctggaggatg cagctgctgt agacttccag ttctccaagg gtgctgtgta ctggacagat       240
     gtgagcgagg aggccatcaa acagacctac ctgaaccaga ctggagctgc tgcacagaac       300
     attgtcatct cgggcctcgt gtcacctgat ggcctggcct gtgactgggt tggcaagaag       360
     ctgtactgga cggactccga gaccaaccgc attgaggttg ccaacctcaa tgggacgtcc       420
     cgtaaggttc tcttctggca ggacctggac cagccaaggg ccattgccct ggatcctgca       480
     catgggtaca tgtactggac tgactggggg gaagcacccc ggatcgagcg ggcagggatg       540
     gatggcagta cccggaagat cattgtagac tccgacattt actggcccaa tgggctgacc       600
     atcgacctgg aggaacagaa gctgtactgg gccgatgcca agctcagctt catccaccat       660
     gccaacctgg acggctcctt ccggcagaag gtggtggagg gcagcctcac tcaccctttt       720
     gccctgacac tctctgggga cacactctac tggacagact ggcagacccg ctccatccac       780
     gcctgcaaca agtggacagg ggagcagagg aaggagatcc ttagtgctct gtactcaccc       840
     atggacatcc aagtgctgag ccaggagcgg cagcctccct tccacacacc atgcgaggag       900
     gacaacggtg gctgttccca cctgtgcctg ctgtccccga gggagccttt ctactcctgt       960
     gcctgcccca ctggtgtgca gttgcaggac aatggcaaga cgtgcaagac aggggctgag      1020
     gaagtgctgc tgctggctcg gaggacagac ctgaggagga tctctctgga cacccctgac      1080
     ttcacagaca tagtgctgca ggtgggcgac atccggcatg ccattgccat tgactacgat      1140
     cccctggagg gctacgtgta ctggaccgat gatgaggtgc gggctatccg cagggcgtac      1200
     ctagatggct caggtgcgca gacacttgtg aacactgaga tcaatgaccc cgatggcatt      1260
     gctgtggact gggtcgcccg gaacctctac tggacagata caggcactga cagaattgag      1320
     gtgactcgcc tcaacggcac ctcccgaaag atcctggtat ctgaggacct ggacgaaccg      1380
     cgagccattg tgttgcaccc tgtgatgggc ctcatgtact ggacagactg gggggagaac      1440
     cccaaaatcg aatgcgccaa cctagatggg agagatcggc atgtcctggt gaacacctcc      1500
     cttgggtggc ccaatggact ggccctggac ctgcaggagg gcaagctgta ctggggggat      1560
     gccaaaactg ataaaatcga ggtgatcaac atagacggga caaagcggaa gaccctgctt      1620
     gaggacaagc tcccacacat ttttgggttc acactgctgg gggacttcat ctactggacc      1680
     gactggcaga gacgcagtat tgaaagggtc cacaaggtca aggccagccg ggatgtcatc      1740
     attgatcaac tccccgacct gatgggactc aaagccgtga atgtggccaa ggttgtcgga      1800
     accaacccat gtgcggatgg aaatggaggg tgcagccatc tgtgcttctt caccccacgt      1860
     gccaccaagt gtggctgccc cattggcctg gagctgttga gtgacatgaa gacctgcata      1920
     atccccgagg ccttcctggt attcaccagc agagccacca tccacaggat ctccctggag      1980
     actaacaaca acgatgtggc tatcccactc acgggtgtca aagaggcctc tgcactggac      2040
     tttgatgtgt ccaacaatca catctactgg actgatgtta gcctcaagac gatcagccga      2100
     gccttcatga atgggagctc agtggagcac gtgattgagt ttggcctcga ctaccctgaa      2160
     ggaatggctg tggactggat gggcaagaac ctctattggg cggacacagg gaccaacagg      2220
     attgaggtgg cccggctgga tgggcagttc cggcaggtgc ttgtgtggag agaccttgac      2280
     aaccccaggt ctctggctct ggatcctact aaaggctaca tctactggac tgagtggggt      2340
     ggcaagccaa ggattgtgcg ggccttcatg gatgggacca attgtatgac actggtagac      2400
     aaggtgggcc gggccaacga cctcaccatt gattatgccg accagcgact gtactggact      2460
     gacctggaca ccaacatgat tgagtcttcc aacatgctgg gtcaggagcg catggtgata      2520
     gctgacgatc tgccctaccc gtttggcctg actcaatata gcgattacat ttactggact      2580
     gactggaacc tgcatagcat tgaacgggcg gacaagacca gtgggcggaa ccgcaccctc      2640
     atccagggtc acctggactt cgtcatggac atcctggtgt tccactcctc ccgtcaggat      2700
     ggcctcaacg actgcgtgca cagcaatggc cagtgtgggc agctgtgcct cgccatcccc      2760
     ggaggccacc gctgtggctg tgcttcacac tacacgctgg accccagcag ccgcaactgc      2820
     agcccgccct ccaccttctt gctgttcagc cagaaatttg ccatcagccg gatgatcccc      2880
     gatgaccagc tcagcccgga ccttgtccta ccccttcatg ggctgaggaa cgtcaaagcc      2940
     atcaactatg acccgctgga caagttcatc tactgggtgg acgggcgcca gaacatcaag      3000
     agggccaagg acgacggtac ccagccctcc atgctgacct ctcccagcca aagcctgagc      3060
     ccagacagac agccacacga cctcagcatt gacatctaca gccggacact gttctggacc      3120
     tgtgaggcca ccaacactat caatgtccac cggctggatg gggatgccat gggagtggtg      3180
     cttcgagggg accgtgacaa gccaagggcc attgctgtca atgctgagcg agggtacatg      3240
     tactttacca acatgcagga ccatgctgcc aagatcgagc gagcctccct ggatggcaca      3300
     gagcgggagg tcctcttcac cacaggcctc atccgtcccg tggcccttgt ggtggacaat      3360
     gctctgggca agctcttctg ggtggatgcc gacctaaagc gaatcgaaag ctgtgacctc      3420
     tctggggcca accgcctgac cctggaagat gccaacatcg tacagccagt aggtctgaca      3480
     gtgctgggca ggcacctcta ctggatcgac cgccagcagc agatgatcga gcgcgtggag      3540
     aagaccactg gggacaagcg gactagggtt cagggccgtg tcacccacct gacaggcatc      3600
     catgccgtgg aggaagtcag cctggaggag ttctcagccc atccttgtgc ccgagacaat      3660
     ggcggctgct cccacatctg tatcgccaag ggtgatggaa caccgcgctg ctcgtgccct      3720
     gtccacctgg tgctcctgca gaacctgctg acttgtggtg agcctcctac ctgctcccct      3780
     gatcagtttg catgtaccac tggtgagatc gactgcatcc ccggagcctg gcgctgtgac      3840
     ggcttccctg agtgtgctga ccagagtgat gaagaaggct gcccagtgtg ctccgcctct      3900
     cagttcccct gcgctcgagg ccagtgtgtg gacctgcggt tacgctgcga cggtgaggcc      3960
     gactgccagg atcgctctga tgaagctaac tgcgatgctg tctgtctgcc caatcagttc      4020
     cggtgcacca gcggccagtg tgtcctcatc aagcaacagt gtgactcctt ccccgactgt      4080
     gctgatgggt ctgatgagct catgtgtgaa atcaacaagc caccctctga tgacatccca      4140
     gcccacagca gtgccattgg gcccgtcatt ggtatcatcc tctccctctt cgtcatgggc      4200
     ggggtctact ttgtctgcca gcgtgtgatg tgccagcgct acacaggggc cagtgggccc      4260
     tttccccacg agtatgttgg tggagcccct catgtgcctc tcaacttcat agccccaggt      4320
     ggctcacagc acggtccctt cccaggcatc ccgtgcagca agtccgtgat gagctccatg      4380
     agcctggtgg gggggcgcgg cagcgtgccc ctctatgacc ggaatcacgt cactggggcc      4440
     tcatccagca gctcgtccag cacaaaggcc acactatatc cgccgatcct gaacccaccc      4500
     ccgtccccgg ccacagaccc ctctctctac aacgtggacg tgttttattc ttcaggcatc      4560
     ccggccaccg ctagaccata caggccctac gtcattcgag gtatggcacc cccaacaaca      4620
     ccgtgcagca cagatgtgtg tgacagtgac tacagcatca gtcgctggaa gagcagcaaa      4680
     tactacctgg acttgaattc ggactcagac ccctaccccc ccccgcccac cccccacagc      4740
     cagtacctat ctgcagagga cagctgccca ccctcaccag gcactgagag gagttactgc      4800
     cacctcttcc cgcccccacc gtccccctgc acggactcgt cctgacctcg gccgtccacc      4860
     cggccctgct gcctccctgt aaatattttt aaatatgaac aaaggaaaaa tatattttat      4920
     gatttaaaaa ataaatataa ttgggatttt taacaagtga gaaatgtgag cggtgaaggg      4980
     gtgggcaggg ctgggaaaac tttgtacagt ggagaaaata tttataaact taatttttta      5040
     aaa                                                                    5043
//