Dbfetch

ID   AF077375; SV 1; linear; mRNA; STD; MUS; 1116 BP.
XX
AC   AF077375;
XX
DT   16-DEC-1998 (Rel. 58, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus galanin receptor 2 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1116
RX   PUBMED; 9832122.
RA   Pang L., Hashemi T., Lee H.J., Maguire M., Graziano M.P., Bayne M.,
RA   Hawes B., Wong G., Wang S.;
RT   "The mouse GalR2 galanin receptor: genomic organization, cDNA cloning, and
RT   functional characterization";
RL   J. Neurochem. 71(6):2252-2259(1998).
XX
RN   [2]
RP   1-1116
RA   Wang S., Hashemi T., Pang L., Lee H.-J.J., Maguire M., Wong G., Bayne M.,
RA   Hawes B., Graziano P.M.;
RT   ;
RL   Submitted (08-JUL-1998) to the INSDC.
RL   CNS/CV Biological Research, Schering Plough Research Institutes, 2015
RL   Galloping Hill Road, Kenilworth, NJ 07033, USA
XX
DR   MD5; 77d09ab84724bc39860d70f9346d9f5b.
DR   Ensembl-Gn; ENSMUSG00000020793; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019422; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019391; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019361; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019365; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019171; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019815; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018726; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019143; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019254; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019246; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019324; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019279; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019853; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018490; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018778; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000055872; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0033656; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0033599; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0033589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0033590; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0033370; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0034086; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0033231; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0033286; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0033427; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0033417; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0033556; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0033427; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0034131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0032926; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0032838; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1116
FT                   /organism="Mus musculus"
FT                   /strain="129/Sv"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1116
FT                   /codon_start=1
FT                   /product="galanin receptor 2"
FT                   /db_xref="GOA:O88854"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000405"
FT                   /db_xref="InterPro:IPR003907"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1337018"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88854"
FT                   /protein_id="AAC95468.1"
FT                   /translation="MNGSDSQGAEDSSQEGGGGWQPEAVLVPLFFALIFLVGAVGNALV
FT                   LAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI
FT                   FLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYY
FT                   SQSQLANLTVCHPAWSAPRRPWNSCTFCLSYLLPVLVLSLTYARTLHYLWRTVDPVVAG
FT                   SGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYA
FT                   NSCVNPIVYALVSKHFRKGFRKICAGLLRRAPRRASGRVCILAXGNHSGGMLEPESTDL
FT                   TQVKRGSRAPRPRTRTSQTXTTLSRTLDPAC"
XX
SQ   Sequence 1116 BP; 184 A; 373 C; 305 G; 252 T; 2 other;
     atgaatggct cggacagcca gggggcggag gactcgagcc aggaaggtgg cggcggctgg        60
     cagcccgagg cggtcctcgt acccctattt ttcgcgctca tcttcctcgt gggcgctgtg       120
     ggcaacgcgc tggtgctggc ggtgctgctg cgcggcggcc aggcggtcag caccacgaac       180
     ctattcatcc tcaacctggg tgtggccgac ctgtgtttca tcctgtgctg cgtgcctttc       240
     caggccacca tctataccct ggacgattgg gtgtttggct cactgctctg caaggccgtt       300
     catttcctca tcttcctcac tatgcacgcc agcagcttca cgctggccgc tgtctccctg       360
     gacaggtatc tggccatccg ctacccgctg cactcccgag agttgcgcac acctcgaaac       420
     gcgctggcgg ccatcgggct catctggggg ctagcactgc tcttctccgg gccctacctg       480
     agctactaca gtcagtcgca gctggccaat ctgacggtgt gccacccagc gtggagcgca       540
     ccacgacgcc catggaactc ttgcactttt tgtcttagct acctgttgcc agtgctggtg       600
     ctcagcctga cctatgcgcg caccttgcac tacctctggc gcacagttga cccagtagtt       660
     gcaggctcag gttcccagcg cgccaagcgc aaggtgacac ggatgatcgt catcgtggcg       720
     gtactcttct gcctctgttg gatgccccac cacgcgctta tcctctgcgt gtggtttggt       780
     cgctttccgc tcacgcgtgc cacttacgcc ctgcgcatcc tttcacatct agtatcttat       840
     gccaactcgt gtgtcaaccc catcgtttat gctctggtct ccaagcattt ccgcaaaggt       900
     ttccgcaaaa tctgcgcggg cctgctacgc cgtgccccga ggagagcttc aggccgagtg       960
     tgcatcctgg cgcytggaaa ccatagtggt ggcatgctgg aacctgagtc cacagacctg      1020
     acacaggtga agcgaggcag ccgggcccct cgtccccgca cccgcacttc ccaaactngc      1080
     acaaccttga gtagaaccct cgatccagcc tgttaa                                1116
//