spacer

EBI Dbfetch

ID   AF076971; SV 1; linear; mRNA; STD; MUS; 680 BP.
XX
AC   AF076971;
XX
DT   11-AUG-1999 (Rel. 60, Created)
DT   14-JAN-2000 (Rel. 62, Last updated, Version 2)
XX
DE   Mus musculus relaxin/insulin-like protein (Zins3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-680
RA   Conklin D., Lofton-Day C., Lok S., Jaspers S., Ching A., Grant F.,
RA   Haldeman B., Whitmore T., O'Hara P.J.;
RT   "Mouse relaxin/insulin homolog";
RL   Unpublished.
XX
RN   [2]
RP   1-680
RA   Conklin D., Lofton-Day C., Lok S., Jaspers S., Ching A., Grant F.,
RA   Haldeman B., Whitmore T., O'Hara P.J.;
RT   ;
RL   Submitted (07-JUL-1998) to the INSDC.
RL   ZymoGenetics, 1201 Eastlake Ave. East, Seattle, WA 98102, USA
XX
DR   MD5; e8f791e9440d18b3d942956dc8816e3f.
DR   Ensembl-Gn; ENSMUSG00000066090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106869; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..680
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="IMAGE:905403"
FT                   /db_xref="taxon:10090"
FT   CDS             33..440
FT                   /codon_start=1
FT                   /gene="Zins3"
FT                   /product="relaxin/insulin-like protein"
FT                   /db_xref="GOA:Q9WUG6"
FT                   /db_xref="InterPro:IPR016179"
FT                   /db_xref="InterPro:IPR022353"
FT                   /db_xref="MGI:MGI:1346085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUG6"
FT                   /protein_id="AAD48089.1"
FT                   /translation="MKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVRTVIYICASSR
FT                   WRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVRDPQAPKEGLW
FT                   ELKKHSVVSRRDLQALCCREGCSMKELSTLC"
XX
SQ   Sequence 680 BP; 170 A; 181 C; 154 G; 175 T; 0 other;
     accacattgc ttctcatttg ctctccggca ggatgaaggg ccccactctt gctctgtttc        60
     tcctcttagt tctgttggct gtggtggaag taagaagcag gcagactgtg aagctctgtg       120
     gcctggacta cgtgagaaca gttatctaca tctgtgccag ctcacggtgg aggagacatc       180
     tggaggggca tttccactct caacaagctg agacaagaaa ctacctccag ctcctagaca       240
     ggcacgagcc atccaagaaa actctggagc acagccttcc caagacggat ctctcaggac       300
     aggagcttgt tcgagatcca caggcaccca aggaaggtct ttgggaactg aagaagcact       360
     cagtggtatc cagacgagat ctgcaagctc tgtgctgcag ggaaggctgc tccatgaagg       420
     aactcagcac cctctgttag gatgcgccca accccttggc aggcttcagc atgcatctca       480
     atgttctacc atcgagttcc ctgttcagct tctatcacta caaccacggc ttttgatcct       540
     ttccttaaag gtctattatg gcttaaagcc actcttctcc ctgtgctgag gtcaatctac       600
     ttttctttct aaattctaac tactgctttg aagtttcgag tgctgtgcaa aattgcaata       660
     aaaaaaaatg cctgaatcca                                                   680
//


spacer
spacer