Dbfetch

ID   AF075605; SV 1; linear; mRNA; STD; MUS; 1241 BP.
XX
AC   AF075605;
XX
DT   02-JAN-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus kappa3-related opioid receptor isoform E (Kor3) mRNA,
DE   alternatively spliced, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1241
RA   Pan Y.-X., Xu J., Wan B.-L., Zuckerman A.B., Rossi G.C., Leventhal L.,
RA   Pasternak G.W.;
RT   "Identification and differential regional expression of KOR-3/ORL-1 gene
RT   splice variants in mouse brain";
RL   Unpublished.
XX
RN   [2]
RP   1-1241
RA   Pan Y.-X., Xu J., Wan B.-L., Zuckerman A.B., Rossi G.C., Leventhal L.,
RA   Pasternak G.W.;
RT   ;
RL   Submitted (30-JUN-1998) to the INSDC.
RL   Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York Ave., New
RL   York, NY 10021, USA
XX
DR   MD5; e1c995864f6806331a470e50e7d97fa5.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027036; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027002; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026972; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027010; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026752; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026866; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026832; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025947; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026283; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184127; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059991; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059927; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059607; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060383; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059899; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059579; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059686; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059651; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058879; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1241
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             21..662
FT                   /codon_start=1
FT                   /gene="Kor3"
FT                   /product="kappa3-related opioid receptor isoform E"
FT                   /note="KOR-3E; alternatively spliced"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAF21781.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEGQWAVLLPDQSVPHGSCRPL"
XX
SQ   Sequence 1241 BP; 222 A; 356 C; 320 G; 343 T; 0 other;
     tggctttgca gggtgacagc atggagtccc tctttcctgc cccattctgg gaggtcttgt        60
     atggcagcca ctttcaaggg aacctgtctc tcctaaatga gaccgtaccc catcacctgc       120
     tcctcaatgc tagccacagt gccttcctgc cccttggact caaggtcacc atcgtggggc       180
     tctacttggc tgtgtgcatc ggggggctcc tggggaactg cctcgtcatg tatgtcatcc       240
     tcaggcacac caagatgaag actgctacca acatttacat atttaatctg gcactggctg       300
     ataccctggt cttgctgaca ctgcccttcc agggcacaga catccttctg ggcttctggc       360
     catttgggaa tgcactgtgc aagacggtca ttgctatcga ctactacaac atgtttacca       420
     gcactttcac tttgactgcc atgagtgtag accgttatgt agctatctgc caccctatcc       480
     gtgcccttga tgttcggaca tccagtaaag cccaggccgt taatgtggcc atatgggccc       540
     tggcttcggt ggttggtgtt cctgttgcca tcatgggctc agcacaagtg gaggatgaag       600
     gtcagtgggc agtcctcctc cctgaccaat cagttcccca tggttcttgc cggcccctct       660
     gacctcattt ctctcctgca gagatcgagt gcctggtgga gatccccgcc cctcaggact       720
     attggggccc tgtatttgcc atctgcatct tccttttttc cttcatcatc ccggttctga       780
     tcatctctgt ctgctacagc ctcatgattc gacgacttcg tggtgtccgg ctgctttcag       840
     gctcccgaga gaaggaccgg aacctgcgac gcatcacacg gctggtactg gtagttgtgg       900
     ctgtgtttgt gggctgctgg acacctgtgc aggtctttgt cctggttcaa ggactgggtg       960
     ttcagccagg tagtgagact gcagtagcca ttctgcgctt ctgcacagcc ctgggctatg      1020
     tcaacagttg tctcaatccc attctctatg ctttcttgga tgagaacttc aaggcctgct      1080
     ttagaaagtt ctgctgtgct tctgccctgc accgggagat gcaggtttct gatcgtgtgc      1140
     gcagcattgc caaggatgta ggccttggtt gcaagacctc tgagacagta ccacggccgg      1200
     catgactagg cgtggacctg cccatggtgc ctgtcagtcc t                          1241
//