Dbfetch

ID   AF073997; SV 1; linear; mRNA; STD; MUS; 2730 BP.
XX
AC   AF073997;
XX
DT   17-NOV-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus myotubularin related protein 1 isoform A (Mtmr1) mRNA,
DE   complete cds; alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2730
RX   DOI; 10.1093/hmg/7.11.1703.
RX   PUBMED; 9736772.
RA   Laporte J., Blondeau F., Buj-Bello A., Tentler D., Kretz C., Dahl N.,
RA   Mandel J.L.;
RT   "Characterization of the myotubularin dual specificity phosphatase gene
RT   family from yeast to human";
RL   Hum. Mol. Genet. 7(11):1703-1712(1998).
XX
RN   [2]
RP   1-2730
RA   Buj-Bello A.;
RT   ;
RL   Submitted (24-JUN-1998) to the INSDC.
RL   Human Genetics, IGBMC, 1 Rue Laurent Fries, Illkirch 67404, France
XX
DR   MD5; 5541f3cc6707738d3cccaf22a4ad788a.
DR   Ensembl-Gn; ENSMUSG00000015214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015358; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2730
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="E10 embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             129..2138
FT                   /codon_start=1
FT                   /gene="Mtmr1"
FT                   /product="myotubularin related protein 1 isoform A"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:Q9Z2C4"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030587"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2C4"
FT                   /protein_id="AAC77822.1"
FT                   /translation="MDRPVAAAAAASAASCEGAGGPGPGPGASWRPSRVAGGASASSRH
FT                   PSIETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPL
FT                   FPGESIKAIVKDVIYICPFMGAVSGTLTVTDFKMYFKNVERDPHFVLDVPLGVISRVEK
FT                   IGAQSHGDNSCGIEIVCKDMRNLRLAYKQEEQRKLGIFENLNKHAFPLSNGQVLFAFNY
FT                   KEKFPVNGWKVYDPVSEYKRQGLPNESWKISKINSNYEFCDTYPAIIVVPTSVKDDDLS
FT                   KVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHK
FT                   LTIFDARQNSVADTNKAKGGGYENESAYPNAELIFLEIHNIHVMRESLRKLKEIVYPSI
FT                   DESHWLSNVDGTHWLEYIRVLLAGAVRIADKIESGKTSVVIHCSDGWDRTSQLTSLAML
FT                   MLDSYYRTIKGFEALIEKEWISFGHRFALRVGHGDDNHADADRSPIFLQFIDCVWQMTR
FT                   QFPSAFEFNELFLITILDHLYSCLFGTFLCNCEQQRIKEDVYTNTISLWSYINSQLDEF
FT                   SNPFFVNYENHVLYPVASMSHLELWVNYYVRWNPRMRPQMPIHQNLKELLAIKAELQKR
FT                   VEDLQREMATRTISSSSERGSSPTHSATPVHTSV"
XX
SQ   Sequence 2730 BP; 744 A; 581 C; 670 G; 735 T; 0 other;
     tccatggcgg cggccgcttg acgcgagcgg tcaagcagcg aagcagggcg gcagggggcg        60
     cgtcggggag cctggctgcc gctgcactcc ggactgtggc tcaccggagg cgccgggctt       120
     gacgcgtcat ggacaggcca gtggcggcgg cggccgccgc atctgcggcg agctgcgagg       180
     gcgctggggg cccggggcca gggccgggcg ctagctggag accctctcgg gttgcggggg       240
     gcgcctcggc cagctcccgg caccccagca ttgagaccct tgacagtcct acagggtcac       300
     atgttgaatg gtgtaaacag cttatagctg ctacaatttc tagtcagatt tcaggttcag       360
     tgacatcaga aaatgtgtca agagattaca aggctctaag ggatggaaat aaactggcac       420
     agatggaaga agctccactt ttcccaggag aatcaattaa ggccattgtg aaagacgtca       480
     tttatatctg tccatttatg ggagcagtga gtgggaccct gacagtgacg gactttaaaa       540
     tgtacttcaa aaatgtagaa agggacccac atttcgtcct tgatgttcct cttggagtga       600
     tcagcagagt ggagaagatt ggtgcacaga gccatgggga taattcttgt ggtatagaga       660
     ttgtgtgcaa ggatatgagg aacctgagac ttgcatataa gcaggaagaa cagcgaaaac       720
     ttgggatatt tgaaaacctc aacaagcatg cttttcctct ttccaatggg caggtgctat       780
     ttgcattcaa ctataaagaa aagtttccag ttaatggctg gaaagtttat gatccagtgt       840
     ctgaatataa gagacagggc ttgccaaatg agagttggaa aatatcaaaa ataaacagta       900
     attatgagtt ctgtgatacc tatcctgcca tcattgttgt gccaactagt gtgaaagatg       960
     atgacctttc aaaagtggca gcctttcgag cgaaaggcag agtccctgtg ttgtcatgga      1020
     ttcacccaga aagtcaggca acaattacac gttgcagcca gccattagtg ggtcccaatg      1080
     ataaacgctg caaagaagat gagaaatacc tgcagacaat aatggatgct aatgcacagt      1140
     cacataaact tactatcttt gatgccagac aaaacagcgt tgctgatacc aacaaggcaa      1200
     agggtggtgg atatgaaaat gaaagtgctt accctaatgc cgaactcata ttcttggaga      1260
     tccacaatat tcatgtgatg agggagtcac ttcgtaaatt aaaggagatt gtgtatcctt      1320
     caattgatga gtcacattgg ctatccaatg tggatgggac acattggctg gaatatatac      1380
     gggttctcct tgctggggca gtgagaattg ctgataaaat agaatctggg aaaacttccg      1440
     tggtcatcca ctgcagtgat gggtgggatc gaacatccca gctcacatct ctggcaatgc      1500
     tgatgttaga cagttattac cggaccatta aaggatttga ggctctcata gaaaaggagt      1560
     ggataagctt tggacacagg tttgccctga gagtgggcca tggtgatgac aaccatgcag      1620
     atgctgaccg atcacctata tttcttcagt ttattgattg tgtttggcag atgacaagac      1680
     agttcccttc agcatttgag tttaatgaat tattcttgat tacaattttg gatcacctct      1740
     atagttgtct ttttgggacc tttttgtgca actgtgaaca acagcgaatc aaagaggatg      1800
     tatatacaaa tactatatct ttatggtctt atatcaatag ccaactagat gaattctcaa      1860
     atcccttctt tgtgaattat gagaaccatg tgttatatcc tgttgctagt atgagtcact      1920
     tggaattgtg ggtaaattat tatgtacggt ggaatccacg gatgagacca cagatgccaa      1980
     ttcatcagaa tctcaaggaa ctgctggcta tcaaggctga gctgcagaag cgtgtggagg      2040
     acttgcagcg ggagatggcc acccggacca tctcatcttc ctctgagagg ggctcctcac      2100
     ctacccactc agctactcct gtacacacct cagtctgatg aacaaagcca gtaccccggg      2160
     ccatccggct gctctattgt cttccagcag ctcggggacc tggccattga tattatggtt      2220
     ctagcttgtc atcttagctc ttaggactca gcccagggac catttgtggg tggtgaaagc      2280
     tcctattatt aacaagtact tcttttgtgt gaacagcctg tgcccctttt gcgagcagcc      2340
     tcaccctgtg aaccacctgt gtcttgtaca ggtagcttgg gagaaaccag attgaatgca      2400
     gtgcggtatt ttaacttaag agaatcttac accacttctt tccaagttac atcctttgtt      2460
     acgaacaact cgtttactta tagaacacat caccagccat gtggctcctc tcagcctttt      2520
     ggcacaattt aaaaactgtt ttaaatgaaa tgttagtgtg gcaaatgaac cattgccacc      2580
     tgttctacag ttatcagtta tcttcataca agaagtcctg ttcaactggt acaatatgta      2640
     ctgctgtgta catataaggt attttttaaa gagaaacatg cctttatttt cctatgtcct      2700
     tttttatgtt tagaatagcc tgagaaatca                                       2730
//