spacer

EBI Dbfetch

ID   AF073880; SV 1; linear; mRNA; STD; MUS; 682 BP.
XX
AC   AF073880;
XX
DT   24-NOV-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus myotubularin homologous protein 2 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-682
RX   DOI; 10.1093/hmg/7.11.1703.
RX   PUBMED; 9736772.
RA   Laporte J., Blondeau F., Buj-Bello A., Tentler D., Kretz C., Dahl N.,
RA   Mandel J.L.;
RT   "Characterization of the myotubularin dual specificity phosphatase gene
RT   family from yeast to human";
RL   Hum. Mol. Genet. 7(11):1703-1712(1998).
XX
RN   [2]
RP   1-682
RA   Laporte J., Blondeau F., Buj-Bello A., Tentler D., Kretz C., Dahl N.,
RA   Mandel J.L.;
RT   ;
RL   Submitted (23-JUN-1998) to the INSDC.
RL   Human Genetics, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France
XX
DR   MD5; 88ab44364f01d148c3555362007ed3eb.
DR   Ensembl-Gn; ENSMUSG00000031918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034396; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..682
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>682
FT                   /codon_start=1
FT                   /product="myotubularin homologous protein 2"
FT                   /db_xref="GOA:Q9Z2D1"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1924366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2D1"
FT                   /protein_id="AAC80002.1"
FT                   /translation="RAMEKSSSCESLGAQLPAARLPSEDSLSSASTSHSENSVHTKSAS
FT                   AISSDSISTSADNFSPDLRVLREANKLAEMEEPALLPGENIKDMAKDVTYICPFTGAVR
FT                   GTLTVTSYRLYFKSMERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNL
FT                   RFAHKPEGRTRRSIFENLMKYAFPVSNGLPLFAFEYKEVFPENGWKLYDPLLEYRRQGI
FT                   PNESW"
XX
SQ   Sequence 682 BP; 190 A; 151 C; 172 G; 169 T; 0 other;
     cgcgccatgg agaagagctc cagctgcgag agtctcggcg cgcagctccc ggcggcaagg        60
     ctgcccagcg aggactcact gtccagtgct tctacttctc attcagagaa ctcggtgcat       120
     accaaatcag cttctgctat atcatcagat tccatttcaa cctctgcaga caacttttct       180
     cctgacttga gggtcctgag ggaggcaaac aagttagcag aaatggagga accagccctg       240
     cttccaggag agaacattaa agatatggcc aaagatgtga cttacatatg tccattcact       300
     ggtgctgtgc gaggaacgct gactgtcaca agttacaggt tatatttcaa gagcatggag       360
     cgggaccccc catttgttct agatgcttct cttggagtga taagtagagt agaaaaaatt       420
     ggtggtgcat ctagccgagg tgaaaactcc tatggcctgg aaactgtgtg caaggatatc       480
     aggaacttgc gatttgctca taaaccggag gggcgaacaa gaagatccat atttgagaat       540
     ctaatgaaat atgcatttcc tgtgtctaat ggcttgcctc tttttgcttt tgagtataaa       600
     gaagtattcc ccgaaaatgg gtggaaactg tatgaccccc ttctagagta cagaaggcag       660
     ggaattccaa atgaaagctg ga                                                682
//


spacer
spacer