Dbfetch

ID   AF072759; SV 1; linear; mRNA; STD; MUS; 1521 BP.
XX
AC   AF072759;
XX
DT   23-JUL-1998 (Rel. 56, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus fatty acid transport protein 4 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1521
RX   DOI; 10.1073/pnas.95.15.8625.
RX   PUBMED; 9671728.
RA   Hirsch D., Stahl A., Lodish H.F.;
RT   "A family of fatty acid transporters conserved from mycobacterium to man";
RL   Proc. Natl. Acad. Sci. U.S.A. 95(15):8625-8629(1998).
XX
RN   [2]
RP   1-1521
RA   Stahl A., Hirsch D., Lodish H.F.;
RT   ;
RL   Submitted (21-JUN-1998) to the INSDC.
RL   Whitehead Institute, 9 Cambridge Center, Cambridge, MA 02142, USA
XX
DR   MD5; 800dfa3bc956ff416084cb16d9032594.
DR   Ensembl-Gn; ENSMUSG00000059316; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025544; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025491; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025517; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025279; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024742; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025352; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025475; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024488; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024810; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080065; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053664; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0053678; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0053632; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053621; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053356; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054113; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053522; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0053301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0053410; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0053372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0053518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053124; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052633; mus_musculus_wsbeij.
DR   EuropePMC; PMC21126; 9671728.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1521
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1521
FT                   /codon_start=1
FT                   /product="fatty acid transport protein 4"
FT                   /note="FATP4"
FT                   /db_xref="GOA:Q91VE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030304"
FT                   /db_xref="MGI:MGI:1347347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VE0"
FT                   /protein_id="AAC40188.1"
FT                   /translation="HASAHASGMAKLGVEAALINTNLRRDALRHCLDTSKARALIFGSE
FT                   MASAICEIHASLEPTLSLFCSGSWEPSTVPVSTEHLDPLLEDAPKHLPSHPDKGFTDKL
FT                   FYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDIVYDCLPLYHSSRKHRGDWQ
FT                   CLLHGMTVVIRKKFSASRFWDDCIKYNCTVVQYIGELCRYLLNQPPREAESRHKVRMAL
FT                   GNGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDSRVGACGFNSRILSFVYPIRL
FT                   VRVNEDTMELIRGPDGVCIPCQPGQPGQLVGRIIQQDPLRRFDGYLNQGANNKKIANDV
FT                   FKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLHMADVAV
FT                   YGVEVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLYARPIFLRFLPELHKTGTFK
FT                   FQKTELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAYTRIQAGEEKL"
XX
SQ   Sequence 1521 BP; 322 A; 440 C; 428 G; 331 T; 0 other;
     cacgcgtccg cccacgcgtc cggcatggcc aagctgggcg tggaggcggc tctcatcaac        60
     accaacctta ggcgggatgc cctgcgccac tgtcttgaca cctcaaaggc acgagctctc       120
     atctttggca gtgagatggc ctcagctatc tgtgagatcc atgctagcct ggagcccaca       180
     ctcagcctct tctgctctgg atcctgggag cccagcacag tgcccgtcag cacagagcat       240
     ctggaccctc ttctggaaga tgccccgaag cacctgccca gtcacccaga caagggtttt       300
     acagataagc tcttctacat ctacacatcg ggcaccacgg ggctacccaa agctgccatt       360
     gtggtgcaca gcaggtatta tcgtatggct tccctggtgt actatggatt ccgcatgcgg       420
     cctgatgaca ttgtctatga ctgcctcccc ctctaccact caagcaggaa acatcgtggg       480
     gattggcagt gcttactcca cggcatgact gtggtgatcc ggaagaagtt ctcagcctcc       540
     cggttctggg atgattgtat caagtacaac tgcacagtgg tacagtacat tggcgagctc       600
     tgccgctacc tcctgaacca gccaccccgt gaggctgagt ctcggcacaa ggtgcgcatg       660
     gcactgggca acggtctccg gcagtccatc tggaccgact tctccagccg tttccacatc       720
     ccccaggtgg ctgagttcta tggggccact gaatgcaact gtagcctggg caactttgac       780
     agccgggtgg gggcctgtgg cttcaatagc cgcatcctgt cctttgtgta ccctatccgt       840
     ttggtacgtg tcaatgagga taccatggaa ctgatccggg gacccgatgg agtctgcatt       900
     ccctgtcaac caggtcagcc aggccagctg gtgggtcgca tcatccagca ggaccctctg       960
     cgccgtttcg acgggtacct caaccagggt gccaacaaca agaagattgc taatgatgtc      1020
     ttcaagaagg gggaccaagc ctacctcact ggtgacgtcc tggtgatgga tgagctgggt      1080
     tacctgtact tccgagatcg cactggggac acgttccgct ggaaagggga gaatgtatct      1140
     accactgagg tggagggcac actcagccgc ctgcttcata tggcagatgt ggcagtttat      1200
     ggtgttgagg tgccaggaac tgaaggccga gcaggaatgg ctgccgttgc aagtcccatc      1260
     agcaactgtg acctggagag ctttgcacag accttgaaaa aggagctgcc tctgtatgcc      1320
     cgccccatct tcctgcgctt cttgcctgag ctgcacaaga cagggacctt caagttccag      1380
     aagacagagt tgcggaagga gggctttgac ccatctgttg tgaaagaccc gctgttctat      1440
     ctggatgctc ggaagggctg ctacgttgca ctggaccagg aggcctatac ccgcatccag      1500
     gcaggcgagg agaagctgtg a                                                1521
//