spacer

EBI Dbfetch

ID   AF071068; SV 1; linear; mRNA; STD; MUS; 1548 BP.
XX
AC   AF071068;
XX
DT   07-JUL-1998 (Rel. 56, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus aromatic-L-amino-acid decarboxylase mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1548
RA   Duchemin A.M., Quach T.T., Gudehithlu K.F., Hadjiconstantinou M.,
RA   Neff N.H.;
RT   "Cloning of mouse brain aromatic-L-amino-acid decarboxylase cDNA";
RL   Unpublished.
XX
RN   [2]
RP   1-1548
RA   Duchemin A.M., Quach T.T., Gudehithlu K.F., Hadjiconstantinou M.,
RA   Neff N.H.;
RT   ;
RL   Submitted (09-JUN-1998) to the INSDC.
RL   Pharmacology, The Ohio State University, 333 West 10th Avenue, Columbus, OH
RL   43210, USA
XX
DR   MD5; 0094786586386d5e18715a567c97a7ab.
DR   Ensembl-Gn; ENSMUSG00000020182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066237; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178704; mus_musculus.
DR   EuropePMC; PMC3026350; 20923862.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1548
FT                   /organism="Mus musculus"
FT                   /strain="Swiss-Webster"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             13..1455
FT                   /codon_start=1
FT                   /product="aromatic-L-amino-acid decarboxylase"
FT                   /EC_number="4.1.1.28"
FT                   /db_xref="GOA:O88533"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="MGI:MGI:94876"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88533"
FT                   /protein_id="AAC25566.1"
FT                   /translation="MDSREFRRRGKEMVDYIADYLDGIEGRPVYPDVEPGYLRPLIPAT
FT                   APQEPETYEDIIKDIEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFS
FT                   WAASPACTELETVMMDWLGKMLELPEAFLAGRAGEGGGVIQGSASEATLVALLAARTKV
FT                   IRQLQAASPEFTQAAIMEKLVAYTSDQAHSSVERAGLIGGIKLKAVPSDGNFSMRASAL
FT                   REALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICNQEGVWLHIDAAYAGSAFIC
FT                   PEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFNMDPVYLKHSHQDS
FT                   GFITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVELSHEFESLVRQDPRFE
FT                   ICTEVILGLVCFRLKGSNELNETLLQRINSAKKIHLVPCRLRDKFVLRFAVCARTVESA
FT                   HVQLAWEHISDLASSVLRAEKE"
XX
SQ   Sequence 1548 BP; 372 A; 369 C; 422 G; 385 T; 0 other;
     gcctttttca acatggattc ccgtgaattc cggagaagag gcaaggagat ggtggattat        60
     atagctgact atctggatgg cattgagggt cgtccagtgt accctgatgt ggagcctggc       120
     tatcttcggc ccctgatccc tgccactgcc ccccaggagc cagaaacata cgaggacata       180
     atcaaagaca tcgagaagat aatcatgcca ggggtgacac actggcacag tccctatttc       240
     ttcgcttact tccccacggc tagctcatac ccagctatgc ttgcagacat gctgtgtggt       300
     gctattggct gcattggttt ctcctgggct gcaagcccag cgtgcacaga gctggagacc       360
     gtgatgatgg actggctggg gaagatgctg gagctgccag aggccttttt ggctggaaga       420
     gctggggaag ggggaggagt gatccaggga agtgccagtg aagccacctt ggtggcccta       480
     ctggctgctc ggactaaagt tatccgccag ctgcaggcag cctccccaga gttcacacaa       540
     gctgctatca tggaaaagct ggttgcttac acatctgatc aggcgcattc ctctgtagaa       600
     agagctgggt taattggtgg aataaagcta aaagcagtcc cttcggatgg caacttttcc       660
     atgagagctt ctgcccttcg ggaagccctg gagcgggaca aggcagctgg cctgattcca       720
     ttctttgtgg tcgctacact ggggaccaca tcctgctgtt cttttgacaa tctcctggaa       780
     gtgggtccca tctgcaacca agagggtgtg tggctgcaca ttgacgctgc ttacgcgggc       840
     agtgccttta tctgtcctga attccggtat cttctgaatg gtgtggagtt tgcagattcc       900
     tttaacttta atccccacaa gtggcttttg gtgaactttg actgctctgc catgtgggtg       960
     aagaggagga ctgacttaac cggagccttt aatatggacc ctgtttatct aaagcacagt      1020
     caccaggact caggattcat cactgactac aggcactggc agatcccact ggggcgacga      1080
     tttcgctctt tgaaaatgtg gtttgttttt agaatgtacg gagtcaaggg gctgcaggct      1140
     tacatccgaa agcacgtgga gctgtctcat gagtttgagt cactggtacg ccaggaccct      1200
     cgctttgaaa tttgcacaga agtcattctt gggttggtct gcttccggct aaagggctcc      1260
     aatgagttga acgaaactct cttacaaaga ataaacagcg ccaaaaaaat ccacttggtt      1320
     ccatgtcgtc tccgagacaa gtttgtgcta cgctttgctg tgtgcgctcg cactgtggag      1380
     tctgcccacg tgcagctggc ctgggaacac atcagtgatc tagcaagcag tgtgctgagg      1440
     gcagagaaag aatgaaagca gagctgcttc agagatcaaa agttgaaaag aagtttatct      1500
     gaaaactgga aagagaaaaa taactaccac tccgccttcg tgaaatca                   1548
//


spacer
spacer