Dbfetch

ID   AF070556; SV 1; linear; mRNA; STD; HUM; 1564 BP.
XX
AC   AF070556;
XX
DT   05-AUG-1998 (Rel. 56, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens clone 24409 14.3.3 protein mRNA, partial cds.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1564
RX   DOI; 10.1006/abio.1996.0138.
RX   PUBMED; 8619474.
RA   Andersson B., Wentland M.A., Ricafrente J.Y., Liu W., Gibbs R.A.;
RT   "A "double adaptor" method for improved shotgun library construction";
RL   Anal. Biochem. 236(1):107-113(1996).
XX
RN   [2]
RP   1-1564
RX   PUBMED; 9110174.
RA   Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W.,
RA   Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.;
RT   "Large-scale concatenation cDNA sequencing";
RL   Genome Res. 7(4):353-358(1997).
XX
RN   [3]
RP   1-1564
RA   Yu W., Gibbs R.A.;
RT   ;
RL   Submitted (05-JUN-1998) to the INSDC.
RL   Molecular and Human Genetics, Baylor College of Medicine, One Baylor Plaza
RL   S930, Houston, TX 77030, USA
XX
DR   MD5; 76cb375487aeed427313f13a0b1bf138.
DR   Ensembl-Gn; ENSG00000134308; homo_sapiens.
DR   Ensembl-Tr; ENST00000238081; homo_sapiens.
DR   Ensembl-Tr; ENST00000381844; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1564
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="infant"
FT                   /clone_lib="1NIB"
FT                   /clone="I.M.A.G.E. Consortium clone ID 24409"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..524
FT                   /codon_start=3
FT                   /product="14.3.3 protein"
FT                   /note="similar to Homo sapiens mRNA for protein kinase
FT                   regulator 14.3.3 protein with GenBank Accession Number
FT                   X56468"
FT                   /db_xref="GOA:P27348"
FT                   /db_xref="H-InvDB:HIT000065723.13"
FT                   /db_xref="HGNC:HGNC:12854"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="PDB:2BTP"
FT                   /db_xref="PDB:5IQP"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27348"
FT                   /protein_id="AAC28640.1"
FT                   /translation="DKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVF
FT                   YLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSV
FT                   FYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGE
FT                   ECDAAEGAEN"
XX
SQ   Sequence 1564 BP; 482 A; 304 C; 300 G; 478 T; 0 other;
     ccgacaagaa gttgcagctg attaaggact atcgggagaa agtggagtcc gagctgagat        60
     ccatctgcac cacggtgctg gaattgttgg ataaatattt aatagccaat gcaactaatc       120
     cagagagtaa ggtcttctat ctgaaaatga agggtgatta cttccggtac cttgctgaag       180
     ttgcgtgtgg tgatgatcga aaacaaacga tagataattc ccaaggagct taccaagagg       240
     catttgatat aagcaagaaa gagatgcaac ccacacaccc aatccgcctg gggcttgctc       300
     ttaacttttc tgtattttac tatgagattc ttaataaccc agagcttgcc tgcacgctgg       360
     ctaaaacggc ttttgatgag gccattgctg aacttgatac actgaatgaa gactcataca       420
     aagacagcac cctcatcatg cagttgctta gagacaacct aacactttgg acatcagaca       480
     gtgcaggaga agaatgtgat gcggcagaag gggctgaaaa ctaaatccat acagggtgtc       540
     atccttcttt ccttcaagaa acctttttac acatctccat tccttattcc acttggattt       600
     cctatagcaa agaaacccat tcatgtgtat ggaatcaact gtttatagtc ttttcacact       660
     gcagctttgg gaaaacttca ttccttgatt tgtgtttgtc ttggccttcc tggtgtgcag       720
     tactgctgta gaaaagtatt aatagcttca tttcatataa acataagtaa ctcccaaaca       780
     cttatgtaga ggactaaaaa tgtatctggt atttaagtaa tctgaaccag ttctgcaagt       840
     gactgtgttt tgtattactg tgaaaataag aaaatgtagt taattacaat ttaaagagta       900
     ttccacataa cttcttaatt tctacattcc ctcccttact cttcgggggt ttcctttcag       960
     taagcaactt ttccatgctc ttaatgtatt cctttttagt aggaatccgg aagtattaga      1020
     ttgaatggaa aagcacttgc catctctgtc taggggtcac aaattgaaat ggctcctgta      1080
     tcacatacgg aggtcttgtg tatctgtggc aacagggagt ttccttattc actctttatt      1140
     tgctgctgtt taagttgcca acctcccctc ccaataaaaa ttcacttaca cctcctgcct      1200
     ttgtagttct ggtattcact ttactatgtg atagaagtag catgttgctg ccagaataca      1260
     agcattgctt ttggcaaatt aaagtgcatg tcatttctta atacactaga aaggggaaat      1320
     aaattaaagt acacaagtcc aagtctaaaa ctttagtact tttccatgca gatttgtgca      1380
     catgtgagag ggtgtccagt ttgtctagtg attgttattt agagagttgg accactattg      1440
     tgtgttgcta atcattgact gtagtcccaa aaaaagcctt gtgaaaatgt tatgccctat      1500
     gtaacagcag agtaacataa aataaaagta cattttataa accaaaaaaa aaaaaaaaaa      1560
     aaaa                                                                   1564
//