spacer

EBI Dbfetch

ID   AF067421; SV 2; linear; mRNA; STD; MUS; 2305 BP.
XX
AC   AF067421;
XX
DT   04-AUG-1998 (Rel. 56, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus HNF3/forkhead homolog 2 (Foxd3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2305
RX   DOI; 10.1016/S0925-4773(98)00105-1.
RX   PUBMED; 9767163.
RA   Labosky P.A., Kaestner K.H.;
RT   "The winged helix transcription factor Hfh2 is expressed in neural crest
RT   and spinal cord during mouse development";
RL   Mech. Dev. 76(1-2):185-190(1998).
XX
RN   [2]
RP   1-2305
RA   Labosky P.A., Kaestner K.H.;
RT   ;
RL   Submitted (19-MAY-1998) to the INSDC.
RL   Genetics, University of Pennsylvania Medical School, 415 Curie Blvd.,
RL   Philadelphia, PA 19104-6145, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2305
RA   Kessler D., Labosky P.A., Kaestner K.H.;
RT   ;
RL   Submitted (24-JAN-2005) to the INSDC.
RL   Cell & Developmental Biology, University of Pennsylvania Medical School,
RL   421 Curie Blvd., Philadelphia, PA 19104-6058, USA
XX
DR   MD5; 2ac28e22b2fe79c1a70e5b725272ea59.
DR   Ensembl-Gn; ENSMUSG00000067261; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087285; mus_musculus.
DR   EuropePMC; PMC2613157; 18959802.
XX
CC   On Jan 24, 2005 this sequence version replaced gi:3372843.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2305
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /map="44.9 cM"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2305
FT                   /gene="Foxd3"
FT                   /note="synonym: Hfh2"
FT   CDS             320..1717
FT                   /codon_start=1
FT                   /gene="Foxd3"
FT                   /product="HNF3/forkhead homolog 2"
FT                   /function="transcription factor"
FT                   /note="winged helix transcription factor"
FT                   /db_xref="GOA:Q61060"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="MGI:MGI:1347473"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61060"
FT                   /protein_id="AAC28352.2"
FT                   /translation="MTLSGSGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCD
FT                   SPAGPPDLRLDEADEGPPVSAHHGQSQPQALALPTEATGPGNDTGAPEADGCKGGEDAV
FT                   TGGGGPGAGSGATGGLTPNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISN
FT                   RFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLR
FT                   RRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAGPYGLHPAAAAGAYSHPAAAAAAA
FT                   AAAALQYPYALPPVAPVLPPAVPLLPSGELGRKAAAFGSQLGPSLQLQLNTLGAAAAAA
FT                   GTAGAAGTTSLIKSEPSARPSFSIENIIGAGSAAPGGSAGGGGSGGGAGGGGGSGGGGG
FT                   AQSFLRPPGTVQSAALMATHQPLSLSRTTATIAPILSVPLSGQFLQPAASAAAAAAAAV
FT                   QAKWPAQ"
XX
SQ   Sequence 2305 BP; 422 A; 767 C; 729 G; 387 T; 0 other;
     gtcgaggaag gctggtgaag tgagggggtg cggcgtggag aaacctccgg ggtcgcgagc        60
     agtagctgtc tcctcgtaga gaagcgtcga ggaccgcaag agttcgcgga cgcgggctgc       120
     ggacgcagcc ccacaccgct gccaggcctc ctcgtgtgag ctgacccgac agccccgagc       180
     tacctgtgcc ctctcccccc ctcccccggc tttctttcgg gggacactca cacctccttt       240
     gcctgagctc cgcgccgccc ctcgcggccc ccctcgctct ctgctcgctc ctggccgccg       300
     ccaccaaccc cgcggaggga tgaccctctc cggcagcggc agcgccagcg atatgtccgg       360
     ccagacggtg ctgacggccg aggacgtgga catcgatgtg gtgggcgagg gcgacgacgg       420
     gctggaggag aaggacagcg acgccgggtg cgacagcccc gcggggcctc cggacctgcg       480
     cctggacgag gcggacgaag ggccaccggt gagcgctcat cacggccagt ctcaaccgca       540
     agccctggca ctgcccaccg aggcgaccgg gccggggaac gacacgggag ctccggaggc       600
     cgacggctgc aagggcggcg aggacgcggt gacaggcggc ggtgggcccg gcgcgggcag       660
     cggggcgacg ggaggtctga ccccgaacaa gcccaagaac agcctggtga agccacccta       720
     ctcttacatc gcgctcatca ccatggccat cctgcagagc ccgcagaaga agctgaccct       780
     gagcggcatc tgcgagttca tcagcaaccg ttttccgtac taccgggaga agttccccgc       840
     ctggcagaac agcatccgcc acaacctgtc gctcaacgac tgcttcgtca agatcccccg       900
     cgagccgggc aacccgggca agggcaacta ctggaccctg gacccccagt ccgaggacat       960
     gttcgacaac ggcagcttcc tgcggcgccg gaagcgcttc aagcgccacc agcaggagca      1020
     cctgcgcgag cagacggcgc tgatgatgca gagcttcgga gcctacagcc tggcggcggc      1080
     ggcgggcgca ggaccctacg gcctgcaccc cgcggcggct gcgggcgcct actcgcaccc      1140
     cgcggcggcg gcggcggccg cggctgctgc ggcgctccag tacccgtacg cgctaccacc      1200
     cgtggctccc gtgctgccgc ccgcagtgcc cctgctgccc tcgggcgagc tgggccgcaa      1260
     agcggccgcc ttcggctcgc agctcggtcc gagcctgcag ctacagctca acaccctggg      1320
     cgccgccgcg gcagccgcgg gcacggcggg cgcggcgggc accacgtcgc tcatcaagtc      1380
     cgagcccagt gcgcggccgt cgttcagcat cgagaacatc ataggcgcgg gatccgcggc      1440
     gcccgggggc tcggctgggg gtggtgggag cggcggcgga gccgggggtg gcgggggcag      1500
     tgggggcggc ggcggcgcgc agtccttcct gcggccgccc gggactgtgc agtcggctgc      1560
     gctcatggcc acgcaccagc ccctgtcgct gagccggacg actgccacca tcgcgcccat      1620
     tctgagcgtg ccgctgtctg gacagttcct gcagcccgca gcctcagccg cagcggctgc      1680
     ggccgccgcc gtgcaagcca agtggcccgc tcaatagtga tgagctagtg gccgggccgg      1740
     acggcggcct ctggcagcag cctgctcttc caggcggtac gccctctctg atcctggtcc      1800
     atctgtcctg gtcctggtcc tggtccctct acccaatcct ggactctgct acccgccccc      1860
     gactccccaa cactgaccaa cagcggcctc catcccctca ctcacctaag ctggcggagc      1920
     aaactcaacc cgtccgctgg gaataacttt ccagtacagg taaaactgat aaccgaattt      1980
     ccaaaaatgc accccgacgg cgccgttgtt ctcagtactg tgggggtggg agggacattc      2040
     tttgtacata tttgtataaa aatcattgac tttccttttg gggtttttat ttttttaaga      2100
     aaataaaaag caattcagta gatttagagc tttgaacttt catatttttt tgaaggttca      2160
     ctctgcgcag ttttatctga gaaaagaatg tataaagact tgggagattt aaatacaaaa      2220
     aatttttcaa aaaggcgaag tgtcattgta ttataaaagt ctgtttatat atgaatgaat      2280
     atatatggta ttctaaatga gcggc                                            2305
//


spacer
spacer