Dbfetch

ID   AF064984; SV 1; linear; mRNA; STD; MUS; 5119 BP.
XX
AC   AF064984;
XX
DT   23-SEP-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus low-density lipoprotein receptor-related protein 5 (Lrp5)
DE   mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5119
RX   DOI; 10.1016/S0378-1119(98)00311-4.
RX   PUBMED; 9714764.
RA   Hey P.J., Twells R.C.J., Phillips M.C., Nakagawa Y., Brown S.D.,
RA   Kawaguchi Y., Cox R., Xie G., Dugan V., Hammond H., Metzker M., Todd J.A.,
RA   Hess J.F.;
RT   "Cloning of a novel member of the low-density lipoprotein receptor family";
RL   Gene 216(1):103-111(1998).
XX
RN   [2]
RP   1-5119
RA   Hey P.J., Twells R.C.J., Phillips M.S., Nakagawa Y., Brown S.D.,
RA   Kawaguchi Y., Cox R., Xie G., Dugan V., Hammond H., Metzker M.L.,
RA   Todd J.A., Hess J.F.;
RT   ;
RL   Submitted (13-MAY-1998) to the INSDC.
RL   Human Genetics, Merck Research Lab, Sumneytown Pike, West Point, PA 19486,
RL   USA
XX
DR   MD5; 992ac1925597b13fa29a632f6af4efbe.
DR   Ensembl-Gn; ENSMUSG00000024913; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024627; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024594; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024565; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024592; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024361; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025040; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023833; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_DBA2J_G0024460; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024427; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024546; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024457; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025088; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023579; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023896; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025856; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050297; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050277; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050235; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050229; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049972; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050723; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050099; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_DBA2J_T0050000; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049971; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050129; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049971; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050837; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0049701; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049270; mus_musculus_wsbeij.
DR   EuropePMC; PMC419982; 11741193.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5119
FT                   /organism="Mus musculus"
FT                   /chromosome="19"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             113..4957
FT                   /codon_start=1
FT                   /gene="Lrp5"
FT                   /product="low-density lipoprotein receptor-related protein
FT                   5"
FT                   /note="LRP5"
FT                   /db_xref="GOA:Q91VN0"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017049"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="MGI:MGI:1278315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VN0"
FT                   /protein_id="AAC36468.1"
FT                   /translation="METAPTRAPPPPPPPLLLLVLYCSLVPAAASPLLLFANRRDVRLV
FT                   DAGGVKLESTIVASGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQNIVIS
FT                   GLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGY
FT                   MYWTDWGEAPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRAN
FT                   LDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSPM
FT                   DIQVLSQERQPPFHTPCEEDNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKTGAE
FT                   EVLLLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRA
FT                   YLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLD
FT                   EPRAIVLHPVMGLMYWTDWGENPKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLY
FT                   WGDAKTDKIEVINIDGTKRKTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKAS
FT                   RDVIIDQLPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCFFTPRATKCGCPIGLELLSD
FT                   MKTCIIPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVS
FT                   LKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQV
FT                   LVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDY
FT                   ADQRLYWTDLDTNMIESSNMLGQERMVIADDLPYPFGLTQYSDYIYWTDWNLHSIERAD
FT                   KTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHSNGQCGQLCLAIPGGHRCGCASH
FT                   YTLDPSSRNCSPPSTFLLFSQKFAISRMIPDDQLSPDLVLPLHGLRNVKAINYDPLDKF
FT                   IYWVDGRQNIKRAKDDGTQPSMLTSPSQSLSPDRQPHDLSIDIYSRTLFWTCEATNTIN
FT                   VHRLDGDAMGVVLRGDRDKPRAIAVNAERGYMYFTNMQDHAAKIERASLDGTEREVLFT
FT                   TGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHL
FT                   YWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGIHAVEEVSLEEFSAHPCARDNGGCSH
FT                   ICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACTTGEIDCIPGAWRCDGFPE
FT                   CADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEADCQDRSDEANCDAVCLPNQFRCT
FT                   SGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIPAHSSAIGPVIGIILSLFVMGGV
FT                   YFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFIAPGGSQHGPFPGIPCSKSVMSSMS
FT                   LVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDVFYSSGI
FT                   PATARPYRPYVIRGMAPPTTPCSTDVCDSDYSISRWKSSKYYLDLNSDSDPYPPPPTPH
FT                   SQYLSAEDSCPPSPGTERSYCHLFPPPPSPCTDSS"
XX
SQ   Sequence 5119 BP; 1098 A; 1549 C; 1467 G; 1005 T; 0 other;
     gccgcggcgc ccgaggcggg agcaagaggc gccgggagcc gcgaggatcc accgccgccg        60
     cgcgcgccat ggagcccgag tgagcgcgcg gcgctcccgg ccgccggacg acatggaaac       120
     ggcgccgacc cgggcccctc cgccgccgcc gccgccgctg ctgctgctgg tgctgtactg       180
     cagcttggtc cccgccgcgg cctcaccgct cctgttgttt gccaaccgcc gggatgtgcg       240
     gctagtggat gccggcggag tgaagctgga gtccaccatt gtggccagtg gcctggagga       300
     tgcagctgct gtagacttcc agttctccaa gggtgctgtg tactggacag atgtgagcga       360
     ggaggccatc aaacagacct acctgaacca gactggagct gctgcacaga acattgtcat       420
     ctcgggcctc gtgtcacctg atggcctggc ctgtgactgg gttggcaaga agctgtactg       480
     gacggactcc gagaccaacc gcattgaggt tgccaacctc aatgggacgt cccgtaaggt       540
     tctcttctgg caggacctgg accagccaag ggccattgcc ctggatcctg cacatgggta       600
     catgtactgg actgactggg gggaagcacc ccggatcgag cgggcaggga tggatggcag       660
     tacccggaag atcattgtag actccgacat ttactggccc aatgggctga ccatcgacct       720
     ggaggaacag aagctgtact gggccgatgc caagctcagc ttcatccacc gtgccaacct       780
     ggacggctcc ttccggcaga aggtggtgga gggcagcctc actcaccctt ttgccctgac       840
     actctctggg gacacactct actggacaga ctggcagacc cgctccatcc acgcctgcaa       900
     caagtggaca ggggagcaga ggaaggagat ccttagtgct ctgtactcac ccatggacat       960
     ccaagtgctg agccaggagc ggcagcctcc cttccacaca ccatgcgagg aggacaacgg      1020
     tggctgttcc cacctgtgcc tgctgtcccc gagggagcct ttctactcct gtgcctgccc      1080
     cactggtgtg cagttgcagg acaatggcaa gacgtgcaag acaggggctg aggaagtgct      1140
     gctgctggct cggaggacag acctgaggag gatctctctg gacacccctg acttcacaga      1200
     catagtgctg caggtgggcg acatccggca tgccattgcc attgactacg atcccctgga      1260
     gggctacgtg tactggaccg atgatgaggt gcgggctatc cgcagggcgt acctagatgg      1320
     ctcaggtgcg cagacacttg tgaacactga gatcaatgac cccgatggca ttgctgtgga      1380
     ctgggtcgcc cggaacctct actggacaga tacaggcact gacagaattg aggtgactcg      1440
     cctcaacggc acctcccgaa agatcctggt atctgaggac ctggacgaac cgcgagccat      1500
     tgtgttgcac cctgtgatgg gcctcatgta ctggacagac tggggggaga accccaaaat      1560
     cgaatgcgcc aacctagatg ggagagatcg gcatgtcctg gtgaacacct cccttgggtg      1620
     gcccaatgga ctggccctgg acctgcagga gggcaagctg tactgggggg atgccaaaac      1680
     tgataaaatc gaggtgatca acatagacgg gacaaagcgg aagaccctgc ttgaggacaa      1740
     gctcccacac atttttgggt tcacactgct gggggacttc atctactgga ccgactggca      1800
     gagacgcagt attgaaaggg tccacaaggt caaggccagc cgggatgtca tcattgatca      1860
     actccccgac ctgatgggac tcaaagccgt gaatgtggcc aaggttgtcg gaaccaaccc      1920
     atgtgcggat ggaaatggag ggtgcagcca tctgtgcttc ttcaccccac gtgccaccaa      1980
     gtgtggctgc cccattggcc tggagctgtt gagtgacatg aagacctgca taatccccga      2040
     ggccttcctg gtattcacca gcagagccac catccacagg atctccctgg agactaacaa      2100
     caacgatgtg gctatcccac tcacgggtgt caaagaggcc tctgcactgg actttgatgt      2160
     gtccaacaat cacatctact ggactgatgt tagcctcaag acgatcagcc gagccttcat      2220
     gaatgggagc tcagtggagc acgtgattga gtttggcctc gactaccctg aaggaatggc      2280
     tgtggactgg atgggcaaga acctctattg ggcggacaca gggaccaaca ggattgaggt      2340
     ggcccggctg gatgggcagt tccggcaggt gcttgtgtgg agagaccttg acaaccccag      2400
     gtctctggct ctggatccta ctaaaggcta catctactgg actgagtggg gtggcaagcc      2460
     aaggattgtg cgggccttca tggatgggac caattgtatg acactggtag acaaggtggg      2520
     ccgggccaac gacctcacca ttgattatgc cgaccagcga ctgtactgga ctgacctgga      2580
     caccaacatg attgagtctt ccaacatgct gggtcaggag cgcatggtga tagctgacga      2640
     tctgccctac ccgtttggcc tgactcaata tagcgattac atctactgga ctgactggaa      2700
     cctgcatagc attgaacggg cggacaagac cagtgggcgg aaccgcaccc tcatccaggg      2760
     tcacctggac ttcgtcatgg acatcctggt gttccactcc tcccgtcagg atggcctcaa      2820
     cgactgcgtg cacagcaatg gccagtgtgg gcagctgtgc ctcgccatcc ccggaggcca      2880
     ccgctgtggc tgtgcttcac actacacgct ggaccccagc agccgcaact gcagcccgcc      2940
     ctccaccttc ttgctgttca gccagaaatt tgccatcagc cggatgatcc ccgatgacca      3000
     gctcagcccg gaccttgtcc taccccttca tgggctgagg aacgtcaaag ccatcaacta      3060
     tgacccgctg gacaagttca tctactgggt ggacgggcgc cagaacatca agagggccaa      3120
     ggacgacggt acccagccct ccatgctgac ctctcccagc caaagcctga gcccagacag      3180
     acagccacac gacctcagca ttgacatcta cagccggaca ctgttctgga cctgtgaggc      3240
     caccaacact atcaatgtcc accggctgga tggggatgcc atgggagtgg tgcttcgagg      3300
     ggaccgtgac aagccaaggg ccattgctgt caatgctgag cgagggtaca tgtactttac      3360
     caacatgcag gaccatgctg ccaagatcga gcgagcctcc ctggatggca cagagcggga      3420
     ggtcctcttc accacaggcc tcatccgtcc cgtggccctt gtggtggaca atgctctggg      3480
     caagctcttc tgggtggatg ccgacctaaa gcgaatcgaa agctgtgacc tctctggggc      3540
     caaccgcctg accctggaag atgccaacat cgtacagcca gtaggtctga cagtgctggg      3600
     caggcacctc tactggatcg accgccagca gcagatgatc gagcgcgtgg agaagaccac      3660
     tggggacaag cggactaggg ttcagggccg tgtcacccac ctgacaggca tccatgccgt      3720
     ggaggaagtc agcctggagg agttctcagc ccatccttgt gcccgagaca atggcggctg      3780
     ctcccacatc tgtatcgcca agggtgatgg aacaccgcgc tgctcgtgcc ctgtccacct      3840
     ggtgctcctg cagaacctgc tgacttgtgg tgagcctcct acctgctccc ctgatcagtt      3900
     tgcatgtacc actggtgaga tcgactgcat ccccggagcc tggcgctgtg acggcttccc      3960
     tgagtgtgct gaccagagtg atgaagaagg ctgcccagtg tgctccgcct ctcagttccc      4020
     ctgcgctcga ggccagtgtg tggacctgcg gttacgctgc gacggtgagg ccgactgcca      4080
     ggatcgctct gatgaagcta actgcgatgc tgtctgtctg cccaatcagt tccggtgcac      4140
     cagcggccag tgtgtcctca tcaagcaaca gtgtgactcc ttccccgact gtgctgatgg      4200
     gtctgatgag ctcatgtgtg aaatcaacaa gccaccctct gatgacatcc cagcccacag      4260
     cagtgccatt gggcccgtca ttggtatcat cctctccctc ttcgtcatgg gcggggtcta      4320
     ctttgtctgc cagcgtgtga tgtgccagcg ctacacaggg gccagtgggc cctttcccca      4380
     cgagtatgtt ggtggagccc ctcatgtgcc tctcaacttc atagccccag gtggctcaca      4440
     gcacggtccc ttcccaggca tcccgtgcag caagtccgtg atgagctcca tgagcctggt      4500
     gggggggcgc ggcagcgtgc ccctctatga ccggaatcac gtcactgggg cctcatccag      4560
     cagctcgtcc agcacaaagg ccacactata tccgccgatc ctgaacccac ccccgtcccc      4620
     ggccacagac ccctctctct acaacgtgga cgtgttttat tcttcaggca tcccggccac      4680
     cgctagacca tacaggccct acgtcattcg aggtatggca cccccaacaa caccgtgcag      4740
     cacagatgtg tgtgacagtg actacagcat cagtcgctgg aagagcagca aatactacct      4800
     ggacttgaat tcggactcag acccctaccc ccccccgccc accccccaca gccagtacct      4860
     atctgcagag gacagctgcc caccctcacc aggcactgag aggagttact gccacctctt      4920
     cccgccccca ccgtccccct gcacggactc gtcctgacct cggccgtcca cccggccctg      4980
     ctgcctccct gtaaatattt ttaaatatga acaaaggaaa aatatatttt atgatttaaa      5040
     aaataaatat aattggggtt tttaacaagt gagaaatgtg agcggtgaag gggtgggcag      5100
     ggctgggaaa cttttctag                                                   5119
//