spacer

EBI Dbfetch

ID   AF062381; SV 1; linear; mRNA; STD; MUS; 1244 BP.
XX
AC   AF062381;
XX
DT   02-JAN-2000 (Rel. 62, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus kappa 3-related opioid receptor KOR3e (Kor3) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1244
RA   Pan Y.-X., Xu J., Wan B.-L., Zuckerman A.B., Pasternak G.W.;
RT   "Identification and differential regional expression of KOR3/ORL1 gene
RT   splice variants in mouse brain";
RL   Unpublished.
XX
RN   [2]
RP   1-1244
RA   Pan Y.-X., Xu J., Wan B.-L., Zuckerman A.B., Pasternak G.W.;
RT   ;
RL   Submitted (30-APR-1998) to the INSDC.
RL   Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York Ave, New York,
RL   NY 10021, USA
XX
DR   MD5; 49c68c3a4174de3df95bcaa08aa22ad2.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1244
FT                   /organism="Mus musculus"
FT                   /strain="C57 Black/6"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             22..663
FT                   /codon_start=1
FT                   /gene="Kor3"
FT                   /product="kappa 3-related opioid receptor KOR3e"
FT                   /note="alternatively spliced variant e of KOR3"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAF21258.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEGQWAVLLPDQSVPHGSCRPL"
XX
SQ   Sequence 1244 BP; 223 A; 356 C; 322 G; 343 T; 0 other;
     gtggctttgc agggtgacag catggagtcc ctctttcctg ccccattctg ggaggtcttg        60
     tatggcagcc actttcaagg gaacctgtct ctcctaaatg agaccgtacc ccatcacctg       120
     ctcctcaatg ctagccacag tgccttcctg ccccttggac tcaaggtcac catcgtgggg       180
     ctctacttgg ctgtgtgcat cggggggctc ctggggaact gcctcgtcat gtatgtcatc       240
     ctcaggcaca ccaagatgaa gactgctacc aacatttaca tatttaatct ggcactggct       300
     gataccctgg tcttgctgac actgcccttc cagggcacag acatccttct gggcttctgg       360
     ccatttggga atgcactgtg caagacggtc attgctatcg actactacaa catgtttacc       420
     agcactttca ctttgactgc catgagtgta gaccgttatg tagctatctg ccaccctatc       480
     cgtgcccttg atgttcggac atccagtaaa gcccaggccg ttaatgtggc catatgggcc       540
     ctggcttcgg tggttggtgt tcctgttgcc atcatgggct cagcacaagt ggaggatgaa       600
     ggtcagtggg cagtcctcct ccctgaccaa tcagttcccc atggttcttg ccggcccctc       660
     tgacctcatt tctctcctgc agagatcgag tgcctggtgg agatccccgc ccctcaggac       720
     tattggggcc ctgtatttgc catctgcatc ttcctttttt ccttcatcat cccggttctg       780
     atcatctctg tctgctacag cctcatgatt cgacgacttc gtggtgtccg gctgctttca       840
     ggctcccgag agaaggaccg gaacctgcga cgcatcacac ggctggtact ggtagttgtg       900
     gctgtgtttg tgggctgctg gacacctgtg caggtctttg tcctggttca aggactgggt       960
     gttcagccag gtagtgagac tgcagtagcc attctgcgct tctgcacagc cctgggctat      1020
     gtcaacagtt gtctcaatcc cattctctat gctttcttgg atgagaactt caaggcctgc      1080
     tttagaaagt tctgctgtgc ttctgccctg caccgggaga tgcaggtttc tgatcgtgtg      1140
     cgcagcattg ccaaggatgt aggccttggt tgcaagacct ctgagacagt accacggccg      1200
     gcatgactag gcgtggacct gcccatggtg cctgtcagtc ctag                       1244
//


spacer
spacer