Dbfetch

ID   AF061934; SV 1; linear; mRNA; STD; MUS; 1917 BP.
XX
AC   AF061934;
XX
DT   04-NOV-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus regulator of G-protein signaling 11 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1917
RA   He W., Wensel T.G.;
RT   ;
RL   Submitted (28-APR-1998) to the INSDC.
RL   Verna and Marrs McLean Department of Biochemistry, Baylor College of
RL   Medicine, One Baylor Plaza, Houston, TX 77030, USA
XX
DR   MD5; 9c8e7b493697ec2238e8d3a2b73dd6b6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1917
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1317
FT                   /codon_start=1
FT                   /product="regulator of G-protein signaling 11"
FT                   /note="RGS11"
FT                   /db_xref="GOA:Q9Z2H1"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR036284"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="MGI:MGI:1354739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2H1"
FT                   /protein_id="AAC70012.1"
FT                   /translation="VSMQDPDQGVKMRSQRLLITVIPHAVAGRDLVEWLVQKFCILEDE
FT                   ALHLGTLLAQHGYIYPLRESRDLTLRPDETPYMFQTPYFWTSTMWPAAELDYAIYLAKK
FT                   NIQKQGALVDYEKEHYALLHKKINHAWDLVLMQAREQLRAAKQRRKGDRMVISCQEQTY
FT                   WLVNKPPPGAPNILEQGPERGSYNPSHMQMSSDFYKCEIECFRKALGRNRVKSSACLEA
FT                   YLKFSSQHGPHDPIMSGCLPSNPWITDDVTYWAMNAPNVAAPTKLRVERWSFSFRELLD
FT                   DPVGRAHFMDFLHNEFSAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLAPGAARWIN
FT                   IDSRTMERTLEGLRQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGLLEEAVIPLET
FT                   KRWPFPFLRKPLHSSPSPALQSTPREPAATSSPEGADGE"
XX
SQ   Sequence 1917 BP; 433 A; 564 C; 509 G; 411 T; 0 other;
     gtgagtatgc aggaccctga ccaaggcgtg aagatgcgga gccagcgcct tctgatcact        60
     gtcattcccc acgcggtagc gggcagagac ctcgtggaat ggctggttca gaagttctgc       120
     atcttggagg atgaagccct gcacctgggc acactcctgg cgcagcacgg ctacatctac       180
     ccactgcgtg agtcccgaga cctgacactc aggccggacg agacccccta catgttccag       240
     acaccctact tttggacaag cactatgtgg ccagctgctg agctagacta tgccatctat       300
     ctggctaaga agaacatcca gaaacaaggg gctttagtgg actatgagaa ggaacattat       360
     gccctgctgc acaagaagat caaccatgca tgggatctgg tattgatgca ggctcgagag       420
     cagctgcggg ctgctaagca gcggcggaag ggagacagaa tggtcatttc gtgtcaggag       480
     cagacatact ggctggtgaa taagccccct cctggggcac ctaacatttt ggagcagggt       540
     cctgagaggg gctcttacaa ccccagtcac atgcagatga gctcggattt ctataagtgt       600
     gagatcgagt gcttcaggaa ggcactgggc aggaaccggg tgaagtcctc tgcctgcctc       660
     gaggcgtacc tgaagttcag cagccagcac gggccgcacg atcccatcat gtcagggtgt       720
     ctgcccagca acccctggat cacagatgat gtcacctact gggccatgaa tgcgcccaac       780
     gtggctgccc ccacaaaact ccgcgttgag cgatggagct tcagcttccg ggagctgctg       840
     gatgaccccg tggggcgtgc ccacttcatg gactttctcc acaacgaatt cagtgcggaa       900
     aacctcagct tctgggaggc atgtgaggag ctgcgctttg gcggacaggc ccaggtcccc       960
     accttggtgg actctgtgta tcagcagttc ctggcccctg gagctgcccg ctggatcaac      1020
     attgacagca ggacgatgga gcggaccctg gaggggctgc gccagccaca ccgctatgtc      1080
     ctggatgcag cacagcttca catctacatg ctcatgaaga aggactccta tccaaggttc      1140
     ctgaagtctg acatatacaa gggcctgctg gaggaagctg tgattccact ggagacaaag      1200
     cgctggccat ttccattctt gcggaagcct ctgcactcaa gccccagccc tgctctccag      1260
     tctaccccca gggagcctgc agcaaccagt tcccctgaag gtgccgatgg agagtagtag      1320
     gtggctcttg ctgcatacct caccttacca tcacctgcct gacaccctgt ggggttgtgt      1380
     tctcctaacg gagattcccc agcactggca tcactgtgta cacagtgagg tcctttagtc      1440
     ttcagttcag gactaggctg tctcaactct aaaatgtcaa gtcagtgaca catgaggagg      1500
     tatcagtctc tggccatgcc accccatgca ggaaggctcc tccactgtat agtcctcctc      1560
     aggctaaacc cagtggcttc ttaggagacg atgtctgcag gtgccatgtc attgccgtac      1620
     gtggcgtctc ttccacctgt cgtctgatca gctctctaga aaggcgacag cacactgctg      1680
     tcctgactac agggctccca gttctcatcg ggcaagtctt tgtcaagctg gcagccctgg      1740
     catccaatcc agtcttcctg tccaggttgt tcagtgccac cagcattgcc acccccaccc      1800
     cagaggtaga aataaagatg gggcctcctg ccatgcagct cccaataggg ctgctctcta      1860
     gtctcccttc acaacccatt ttcacagaaa taaaactttc agtcccctgc aaaaaaa         1917
//