spacer

EBI Dbfetch

ID   AF061569; SV 1; linear; mRNA; STD; MUS; 2223 BP.
XX
AC   AF061569;
XX
DT   01-JUL-1998 (Rel. 56, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus coding region determinant binding protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2223
RX   PUBMED; 1559612.
RA   Bernstein P.L., Herrick D.J., Prokipcak R.D., Ross J.;
RT   "Control of c-myc mRNA half-life in vitro by a protein capable of binding
RT   to a coding region stability determinant";
RL   Genes Dev. 6(4):642-654(1992).
XX
RN   [2]
RP   1-2223
RX   PUBMED; 8114742.
RA   Herrick D.J., Ross J.;
RT   "The half-life of c-myc mRNA in growing and serum-stimulated cells:
RT   influence of the coding and 3' untranslated regions and role of ribosome
RT   translocation";
RL   Mol. Cell. Biol. 14(3):2119-2128(1994).
XX
RN   [3]
RP   1-2223
RX   PUBMED; 8132663.
RA   Prokipcak R.D., Herrick D.J., Ross J.;
RT   "Purification and properties of a protein that binds to the C-terminal
RT   coding region of human c-myc mRNA";
RL   J Biol Chem 269(12):9261-9269(1994).
XX
RN   [4]
RP   1-2223
RX   DOI; 10.1038/sj.onc.1201093.
RX   PUBMED; 9178888.
RA   Leeds P., Kren B.T., Boylan J.M., Betz N.A., Steer C.J., Gruppuso P.A.,
RA   Ross J.;
RT   "Developmental regulation of CRD-BP, an RNA-binding protein that stabilizes
RT   c-myc mRNA in vitro";
RL   Oncogene 14(11):1279-1286(1997).
XX
RN   [5]
RP   1-2223
RX   DOI; 10.1093/nar/26.22.5036.
RX   PUBMED; 9801297.
RA   Doyle G.A., Betz N.A., Leeds P.F., Fleisig A.J., Prokipcak R.D., Ross J.;
RT   "The c-myc coding region determinant-binding protein: a member of a family
RT   of KH domain RNA-binding proteins";
RL   Nucleic Acids Res. 26(22):5036-5044(1998).
XX
RN   [6]
RP   1-2223
RA   Ross J., Prokipcak R.D., Leeds P., Doyle G.A.R., Betz N.A., Fleisig A.J.;
RT   ;
RL   Submitted (25-APR-1998) to the INSDC.
RL   McArdle Laboratory, University of Wisconsin - Madison, 1400 University
RL   Ave., Madison, WI 53706, USA
XX
DR   MD5; 434e22cf4c6846acfa87d079c0fb0e3f.
DR   Ensembl-Gn; ENSMUSG00000013415; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013559; mus_musculus.
DR   EuropePMC; PMC116055; 9891060.
DR   EuropePMC; PMC147974; 9801297.
DR   EuropePMC; PMC400488; 15121863.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2223
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             131..1864
FT                   /codon_start=1
FT                   /product="coding region determinant binding protein"
FT                   /function="putative c-myc mRNA binding protein"
FT                   /note="CRD-BP"
FT                   /db_xref="GOA:O88477"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1890357"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88477"
FT                   /protein_id="AAC72743.1"
FT                   /translation="MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCP
FT                   DEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQY
FT                   GTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQITQGP
FT                   ENGRRGGFGSRGQPRQGSPVAAGAPAKQQPVDIPLRLLVPTQYVGAIIGKEGATIRNIT
FT                   KQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKI
FT                   LAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAE
FT                   QEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSF
FT                   MQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVVITG
FT                   PPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLT
FT                   AAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNLAQARR
FT                   K"
XX
SQ   Sequence 2223 BP; 578 A; 608 C; 618 G; 419 T; 0 other;
     gggtggggtg ggtagaaagt ttgcggctcc cgccgcccgt atccacgcct atcggcatag        60
     gaggatatcc gcccgcgccc gcccggatcg gcattgaatg gaacagtgtc cttgccccgc       120
     caccgccacc atgaacaagc tttacatcgg caacctcaac gagagtgtga cccccgcaga       180
     cttggagaaa gtattcgcgg agcacaagat ctcctacagc ggccagttct tggtcaaatc       240
     cggctacgcc ttcgtggatt gccccgacga gcactgggcg atgaaggcca tcgaaacttt       300
     ctcggggaaa gtagaactgc aaggaaaacg tctagagatt gaacactcag tccccaaaaa       360
     acaaaggagt cggaaaatac agatccgcaa tattccacct cagctccgat gggaagtgct       420
     agatagcctg ctggctcagt acggtacagt ggagaactgt gagcaagtga acactgaaag       480
     tgagacagcg gtggtcaacg tcacctactc taaccgggag cagaccaggc aagctatcat       540
     gaagctaaat ggccatcaac tggagaacca tgccctgaag gtctcctaca tacctgatga       600
     gcagataaca caaggtcctg agaatgggcg tcgtggaggc tttgggtctc ggggccagcc       660
     ccggcaaggg tcgcccgtgg cagcaggggc tccagccaag cagcagccag tggacatccc       720
     tctccggctc ctggtgccta cgcagtatgt aggcgctatc attggcaagg agggtgccac       780
     catccgaaac atcacaaaac agacgcagtc caaaatagac gtgcatagga aggagaatgc       840
     gggcgctgcg gagaaggcca tcagcgtgca ttcaacccct gaaggctgct cctccgcgtg       900
     caagatgatc ttggagatta tgcacaagga ggcaaaggac accaaaacgg cagatgaagt       960
     tcccctgaag atcctggctc ataacaactt cgtcgggcga ctcattggca aggaaggccg      1020
     gaacctgaag aaggtggagc aggacacaga gacgaagatc accatctcat cgctccagga      1080
     cctcacgctc tataaccctg agaggaccat cactgtgaag ggcgccattg agaactgttg      1140
     cagggccgag caggagatca tgaagaaagt tcgagaggct tacgagaacg acgtggccgc      1200
     catgagcttg cagtcccacc tcatccctgg gcttaacctg gctgctgtag gtctcttccc      1260
     agcttcatcc agcgctgtcc ctcctcctcc cagcagtgtc actggggctg ctccctatag      1320
     ctccttcatg caggctccgg agcaggagat ggtacaagtg ttcatccccg cccaggctgt      1380
     gggcgccatc attggcaaga agggccagca catcaaacaa ctctcccgtt tcgccagcgc      1440
     ctccatcaag attgctccac cagaaacacc tgactccaaa gttcgaatgg tcgtcatcac      1500
     tggaccccca gaggctcagt tcaaggctca gggaagaatt tatggcaaac taaaagaaga      1560
     gaatttcttt ggtcccaagg aggaagtaaa gctagagacc cacatacggg ttccggcttc      1620
     agcagccggc cgcgtcatcg gcaaaggcgg caaaacggtg aatgagctgc agaacttgac      1680
     tgcagctgag gtggtagtgc caagagacca gaccccggat gagaacgacc aagtcattgt      1740
     taagatcatc ggacattttt atgccagcca gatggctcag cggaagatcc gagacatcct      1800
     ggctcaagtt aagcaacagc accagaaggg acagagcaac ctggcccagg ctcggaggaa      1860
     gtgaccccgc cccctcctgt cccattggct ccaagatcag caggaggaac acagaactgg      1920
     aggggcgggt ggagggccgg tgtgtttttc ccagcaggcc tgagaatgag tgggaatcag      1980
     ggcatttggg cctggctgga gatcaggttt gcacactgta ttgagaacaa tgttccagtg      2040
     aggaatcctg atctctcgcc cccaattgag ccagctggcc acagcccacc ccttggaata      2100
     tcaccattgc aatcatagct tgggttgctt ttaaacgtgg attgtcttga agttctccag      2160
     cctccatgga aggatgggtc agatcccagt ggggaagaga ataaaatttc cttcaggttt      2220
     tat                                                                    2223
//


spacer
spacer