spacer

EBI Dbfetch

ID   AF061270; SV 1; linear; mRNA; STD; MUS; 2540 BP.
XX
AC   AF061270;
XX
DT   11-MAY-1998 (Rel. 55, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus homeobox protein PKNOX1 (Pknox1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2540
RA   Nakamura T., Yamazaki Y.;
RT   "Isolation of the mouse Pknox1 homeobox gene";
RL   Unpublished.
XX
RN   [2]
RP   1-2540
RA   Nakamura T., Yamazaki Y.;
RT   ;
RL   Submitted (23-APR-1998) to the INSDC.
RL   PRESTO, Japan Science and Technology Cooperation and the Cancer Institute,
RL   1-37-1 Kami-ikebukuro, Toshima-ku, Tokyo 170-8455, Japan
XX
DR   MD5; e95a5d9c36ee3e23fd158e0b3077db97.
DR   Ensembl-Gn; ENSMUSG00000006705; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097352; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176701; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2540
FT                   /organism="Mus musculus"
FT                   /strain="Swiss Webster/NIH"
FT                   /mol_type="mRNA"
FT                   /dev_stage="11-day embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             149..1456
FT                   /codon_start=1
FT                   /gene="Pknox1"
FT                   /product="homeobox protein PKNOX1"
FT                   /db_xref="GOA:O70477"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1201409"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70477"
FT                   /protein_id="AAC15990.1"
FT                   /translation="MATQTLSIDSYQDGQQMQVVTELKTEQDPNCSDPDAEGVSPPPIE
FT                   SQTPMDADKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKDGK
FT                   PFFCEDPETDNLMVKAIQVLRIHLLELEKVNELCKDFCSRYIACLKTKMNSETLLSGEP
FT                   GSPYSPVQSQQIQSAITGTLSPQGIVVPASALQQGNVTMATVAGGTVYQPVTVVTPQGQ
FT                   VVTQALSPGTIRIQNSQLQLQLNQDLSTLHQEDGSSKNKRGVLPKHATNVMRSWLFQHI
FT                   GHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQPMLDSSCSETPKTKKKPAQNRP
FT                   VQRFWPDSLASGVAQATPSELAMSEGAVVTITTPVNMNVDSLQSLSSDGATLAVQQVMM
FT                   AGQSEDESVDSTEDEGGALAPTHISGLVLENSDSLQ"
XX
SQ   Sequence 2540 BP; 641 A; 627 C; 660 G; 612 T; 0 other;
     gcgtcggcgt gacggttgga cgcgggcgcg gcactgcggg tcccgattgc tgcagccgct        60
     tgtcagtgtg atgaagattg gcacccagac accatgtgct tctcgctcaa gatgatctga       120
     tgtctgaagt ggactctcac taaccatgat ggcgacacag acgctaagta tagacagcta       180
     tcaagatgga cagcaaatgc aggtggtcac ggagttaaaa acagagcaag atcccaactg       240
     ctctgaccca gatgcagaag gagtgagtcc tcctcccatc gagtctcaga ccccaatgga       300
     tgccgacaag caggccattt ataggcatcc actatttccg ttgctagctt tgttgtttga       360
     gaagtgtgag cagtccacac agggctcaga aggcacgacg tctgccagct tcgatgtgga       420
     cattgagaac tttgtcagaa agcaagaaaa ggatgggaaa cccttttttt gtgaagatcc       480
     ggaaactgac aacctaatgg tgaaggcaat ccaggtcctg cgcatccacc tccttgaact       540
     ggagaaggtt aatgagctct gtaaagattt ctgtagtcgg tacattgctt gtctgaagac       600
     aaaaatgaac agcgaaaccc tgttgagtgg ggagcctgga agtccgtact cccctgtgca       660
     atcccagcag attcagagtg ccatcacagg cacgctcagc ccccagggaa tcgtggtgcc       720
     agcatcagcc ctacaacagg gaaatgtaac catggcaaca gtggcaggtg gcacagtgta       780
     ccagcctgtc accgtcgtca ctccgcaagg ccaagtggtc acgcaggcat tatctcctgg       840
     gacaattagg atccagaact cacagctgca gttgcagttg aaccaagacc tcagcacctt       900
     gcatcaagag gatggttcct ccaagaacaa gaggggtgtc ctgccgaagc acgccaccaa       960
     cgtgatgcgg tcctggctct ttcagcacat agggcatccc tacccaacag aggatgagaa      1020
     aaagcagatt gctgctcaga cgaatctgac cctgcttcaa gtcaacaact ggttcatcaa      1080
     cgcgagaaga cgaattctcc agccaatgtt ggattccagc tgctcagaga ctccaaaaac      1140
     gaagaaaaaa cctgctcaga acaggccagt tcagaggttt tggccagatt ctcttgcatc      1200
     aggagtggca caagcaacac ccagcgagct tgccatgtca gaaggtgccg ttgtgaccat      1260
     caccacacct gtaaacatga atgtggacag ccttcagtcc ctgtcctcag acggggccac      1320
     cctggccgta cagcaggtca tgatggcagg gcagagtgag gacgagtcgg tggatagcac      1380
     agaagatgaa ggcggcgccc tggcgcccac acacatcagc gggctggtgc tggagaacag      1440
     cgactccctt cagtaggaag caccaacggg gtcagtgtgg agctgggcgc tggactcttc      1500
     actgtttgca cagcaagcat cttacagttg tctttgtacc ctgttttata tgtagatata      1560
     gaaggtgcac ttttgtattt cgcagcaagc ttcaagacgt ctttgccggt gcagcgactt      1620
     ccttcagatg tgcgtgtatg ggtttttaat gctagaaacg tggcccctgc cccttgagtc      1680
     cttgacgaga ttaaggaaca gtgctgccat tttctaaaat tctgcagttg caattgagtc      1740
     gtgtggttta cagcaggtct gggggcggct gctggtgccg ctcacaggtc tgaaagatga      1800
     cctgcacgca ggctgcagag cgagagggct ctggccccgg tgggctgtgg gtgcccacca      1860
     cacacttcag ttctctcagg cagcatttgc ctgtttcatt tgctatatag aaaaagaaac      1920
     tcctattttt accttgctgg gattattgga taaaaagcta tttttataaa tcagttatta      1980
     attggattat gactatattg aggataaatt tctagagaag caacagcgca tgcttgtctt      2040
     tcgattcgga atgttctgaa aggcggccac ctgctcatgg tctcctgctc tctggggagg      2100
     agagggctcg cctcagctgc taaaaggaaa caactgtcaa gtgagctttt gacatctcca      2160
     gtttctgctc aggtgtgatg cagattgcta cattttacac tcgctagagc atcttacaca      2220
     gtgtactcag taggacgtac ggtaagtgag ggctctgcca cgcctagtct gactgcagtt      2280
     ccatggctgc ctgggtatgt taactgggtg gtaattttag attttttttt tttttagtta      2340
     aaacctgtta tatagagaat gtttattata aactaatata aagtgtgttc tgccccactg      2400
     gctcagagct ggtgtaaaca gcaaacacct aaactgtctt tcttactggc agacacctag      2460
     aagttagaac catggctgta acgtggcggt ggggcccact ggtggctctc actgtcactc      2520
     actctccagg ctcctccccc                                                  2540
//


spacer
spacer