spacer

EBI Dbfetch

ID   AF054843; SV 1; linear; mRNA; STD; MUS; 408 BP.
XX
AC   AF054843;
XX
DT   21-NOV-1999 (Rel. 61, Created)
DT   21-NOV-1999 (Rel. 61, Last updated, Version 1)
XX
DE   Mus musculus relaxin/insulin-like factor variant b mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-408
RA   Hsu S.Y., Hsueh A.J.W.;
RT   ;
RL   Submitted (19-MAR-1998) to the INSDC.
RL   GYN/OB, Stanford University, MSOB S385, Stanford, CA 94305, USA
XX
DR   MD5; e56824123e99b111097111b105de7468.
DR   Ensembl-Gn; ENSMUSG00000066090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106869; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..408
FT                   /organism="Mus musculus"
FT                   /strain="FVB"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..408
FT                   /codon_start=1
FT                   /product="relaxin/insulin-like factor variant b"
FT                   /note="Rif; alternate splice product"
FT                   /db_xref="GOA:Q9WUG6"
FT                   /db_xref="InterPro:IPR016179"
FT                   /db_xref="InterPro:IPR022353"
FT                   /db_xref="MGI:MGI:1346085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUG6"
FT                   /protein_id="AAF09094.1"
FT                   /translation="MKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVRTVIYICASSR
FT                   WRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVRDPQAPKEGLW
FT                   ELKKHSVVSRRDLQALCCREGCSMKELSTLC"
XX
SQ   Sequence 408 BP; 105 A; 106 C; 110 G; 87 T; 0 other;
     atgaagggcc ccactcttgc tctgtttctc ctcttagttc tgttggctgt ggtggaagta        60
     agaagcaggc agactgtgaa gctctgtggc ctggactacg tgagaacagt tatctacatc       120
     tgtgccagct cacggtggag gagacatctg gaggggcatt tccactctca acaagctgag       180
     acaagaaact acctccagct cctagacagg cacgagccat ccaagaaaac tctggagcac       240
     agccttccca agacggatct ctcaggacag gagcttgttc gagatccaca ggcacccaag       300
     gaaggtcttt gggaactgaa gaagcactca gtggtatcca gacgagatct gcaagctctg       360
     tgctgcaggg aaggctgctc catgaaggaa ctcagcaccc tctgttag                    408
//


spacer
spacer