spacer

EBI Dbfetch

ID   AF054842; SV 1; linear; mRNA; STD; MUS; 438 BP.
XX
AC   AF054842;
XX
DT   21-NOV-1999 (Rel. 61, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus relaxin/insulin-like factor variant a mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-438
RA   Hsu S.Y., Hsueh A.J.W.;
RT   ;
RL   Submitted (19-MAR-1998) to the INSDC.
RL   GYN/OB, Stanford University, MSOB S385, Stanford, CA 94305, USA
XX
DR   MD5; e4dbbb665d38d6bbf9399a188fa6c2f0.
DR   Ensembl-Gn; ENSMUSG00000066090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084382; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106869; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..438
FT                   /organism="Mus musculus"
FT                   /strain="FVB"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..438
FT                   /codon_start=1
FT                   /product="relaxin/insulin-like factor variant a"
FT                   /note="Rif; alternate splice product"
FT                   /db_xref="GOA:Q9WUG6"
FT                   /db_xref="InterPro:IPR016179"
FT                   /db_xref="InterPro:IPR022353"
FT                   /db_xref="MGI:MGI:1346085"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUG6"
FT                   /protein_id="AAF09093.1"
FT                   /translation="MCLVNTVKIRMKGPTLALFLLLVLLAVVEVRSRQTVKLCGLDYVR
FT                   TVIYICASSRWRRHLEGHFHSQQAETRNYLQLLDRHEPSKKTLEHSLPKTDLSGQELVR
FT                   DPQAPKEGLWELKKHSVVSRRDLQALCCREGCSMKELSTLC"
XX
SQ   Sequence 438 BP; 116 A; 109 C; 117 G; 96 T; 0 other;
     atgtgcttag taaacactgt taagataagg atgaagggcc ccactcttgc tctgtttctc        60
     ctcttagttc tgttggctgt ggtggaagta agaagcaggc agactgtgaa gctctgtggc       120
     ctggactacg tgagaacagt tatctacatc tgtgccagct cacggtggag gagacatctg       180
     gaggggcatt tccactctca acaagctgag acaagaaact acctccagct cctagacagg       240
     cacgagccat ccaagaaaac tctggagcac agccttccca agacggatct ctcaggacag       300
     gagcttgttc gagatccaca ggcacccaag gaaggtcttt gggaactgaa gaagcactca       360
     gtggtatcca gacgagatct gcaagctctg tgctgcaggg aaggctgctc catgaaggaa       420
     ctcagcaccc tctgttag                                                     438
//


spacer
spacer