spacer

EBI Dbfetch

ID   AF054623; SV 2; linear; mRNA; STD; MUS; 1929 BP.
XX
AC   AF054623;
XX
DT   08-APR-1998 (Rel. 55, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus frizzled-1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1929
RX   DOI; 10.1016/S0945-053X(00)00138-4.
RX   PUBMED; 11334716.
RA   Xu L., Tan L., Goldring M.B., Olsen B.R., Li Y.;
RT   "Expression of frizzled genes in mouse costochondral chondrocytes";
RL   Matrix Biol. 20(2):147-151(2001).
XX
RN   [2]
RP   1-1929
RA   Xu L., Muragaki Y., Olsen B., Li Y.;
RT   ;
RL   Submitted (18-MAR-1998) to the INSDC.
RL   Cell Biology, Harvard Medical School, 220 Longwood Ave., Boston, MA 02115,
RL   USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1929
RA   Xu L., Muragaki Y., Olsen B., Li Y.;
RT   ;
RL   Submitted (04-FEB-2000) to the INSDC.
RL   Cell Biology, Harvard Medical School, 220 Longwood Ave., Boston, MA 02115,
RL   USA
XX
DR   MD5; bdab5886ecc192acdf014a00c0dda25d.
DR   Ensembl-Gn; ENSMUSG00000044674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054294; mus_musculus.
XX
CC   On Feb 4, 2000 this sequence version replaced gi:3025755.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1929
FT                   /organism="Mus musculus"
FT                   /strain="C57BL"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10.5 day embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1929
FT                   /codon_start=1
FT                   /gene="frizzled-1"
FT                   /product="Frizzled-1"
FT                   /db_xref="GOA:O70421"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026548"
FT                   /db_xref="MGI:MGI:1196625"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70421"
FT                   /protein_id="AAC12873.2"
FT                   /translation="MAEEAAPSESRAAGRLSLELCAEALPGRREEVGHEDTASHRRPRA
FT                   DPRRWASGLLLLLWLLEAPLLLGVRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGIS
FT                   IPDHGYCQPISIPLCTDMAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFF
FT                   LCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELC
FT                   VGQNTSDKGTPTPSLLPEFWTSNGQHGGGGYRGGYPGGAGTVERGKFSCPRALRVPSYL
FT                   NYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDM
FT                   PRFSYPERPIISLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTNKEGCTI
FT                   LFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITIL
FT                   ALGQVDGDVLSGVCFLGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKH
FT                   DGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPC
FT                   PHLQGGGGVPPHPPMSPDFTVFMIKYLMTLIVGITSGFRIWSGKTLNSWRKFYTRLTNS
FT                   KQGETTV"
XX
SQ   Sequence 1929 BP; 346 A; 615 C; 590 G; 378 T; 0 other;
     atggctgagg aggcggcgcc tagcgagtcc cgggccgccg gccggctgag cttggaactt        60
     tgtgccgaag cactcccggg ccggcgggag gaggtggggc acgaggacac ggccagccac       120
     cgccgccccc gggctgatcc ccggcgttgg gctagcgggc tgctgctgct gctttggttg       180
     ctggaggctc ctctgctttt gggggtccga gcgcaggcgg cgggccaggt atccggcccg       240
     ggccagcaag ccccgccgcc gccccagccc cagcagagcg ggcagcagta caacggcgaa       300
     cggggcatct ccatcccgga ccacggctac tgccagccca tctccatccc gctgtgcacg       360
     gacatggcgt acaaccagac catcatgccc aacctgctgg gccacacgaa tcaggaggac       420
     gccggtctgg aggtgcacca gttctaccct ctggtgaagg tgcagtgctc cgccgagctc       480
     aagttcttcc tgtgctccat gtacgcgcct gtgtgcaccg tactggagca ggcgctaccg       540
     ccctgccgct ccctgtgcga gcgcgcacgc cagggctgcg aggcgctcat gaacaagttc       600
     ggcttccagt ggccagacac actcaagtgc gagaagttcc cggtgcacgg cgcaggagag       660
     ctgtgcgtgg gccagaacac gtccgacaaa ggcaccccaa ctccctcctt gctaccagag       720
     ttctggacca gtaatggcca gcacggcggc ggtggttacc gcggcggcta cccggggggt       780
     gccgggacgg tggagcgggg aaagttctcc tgcccgcgcg ccctcagggt cccctcctac       840
     ctcaactacc actttctggg ggagaaggac tgcggcgcac cctgcgaacc caccaaggtt       900
     tacgggctca tgtacttcgg gccagaggag ctgcgcttct cgcgcacctg gataggcatc       960
     tggtccgtgc tgtgctgcgc ctccacgctc ttcacggtgc tcacgtacct agtcgacatg      1020
     ccgcgcttca gctacccgga acggcccatc atttccctgt ccggctgtta cacagcggtg      1080
     gcggtggcct acatcgctgg ctttctcttg gaggaccggg tggtgtgcaa cgacaagttt      1140
     gcagaggacg gggcgcgcac ggtggcgcag ggcactaaca aagaaggctg cactatactc      1200
     tttatgatgc tctacttctt cagcatggcc agctccatct ggtgggtgat cctgtccctc      1260
     acctggttcc tggcagccgg catgaagtgg ggccacgaag ccatcgaggc caactcacag      1320
     tatttccatt tagccgcctg ggctgtgcca gccatcaaaa ctataaccat cttggcgttg      1380
     ggccaggtgg atggcgacgt actgagcgga gtgtgttttc tggggctcaa caacgtggac      1440
     gcactgcgtg gctttgtgct ggcgcctctc ttcgtttatc tgttcattgg cacttctttc      1500
     ctgctggccg gtttcgtgtc actcttccgc atccgcacca tcatgaagca tgacggcacc      1560
     aagacagaga agctggagaa gctcatggtg cgcatcggag tcttcagtgt cctctacact      1620
     gtgccggcca ccatcgtcat cgcctgctac ttctatgaac aggcctttcg ggaccagtgg      1680
     gagcgcagct gggtggccca gagctgcaag agttatgcca tcccttgccc tcacctccag      1740
     ggaggtggag gagtcccacc acacccgccc atgagcccag actttacagt cttcatgatc      1800
     aagtatctca tgacgctgat tgtgggcatc acatcgggct tccggatctg gtccggcaag      1860
     acactgaatt cctggaggaa gttctacacg aggcttacca acagcaaaca gggggagact      1920
     accgtctga                                                              1929
//


spacer
spacer