Dbfetch

ID   AF053130; SV 1; linear; mRNA; STD; MUS; 5351 BP.
XX
AC   AF053130;
XX
DT   01-JUN-1998 (Rel. 55, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus unconventional myosin MYO15 (Myo15) mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5351
RX   DOI; 10.1126/science.280.5368.1444.
RX   PUBMED; 9603735.
RA   Probst F.J., Fridell R.A., Raphael Y., Saunders T.L., Wang A., Liang Y.,
RA   Morell R.J., Touchman J.W., Lyons R.H., Noben-Trauth K., Friedman T.B.,
RA   Camper S.A.;
RT   "Correction of deafness in shaker-2 mice by an unconventional myosin in a
RT   BAC transgene";
RL   Science, e1252229 280(5368):1444-1447(1998).
XX
RN   [2]
RP   1-5351
RA   Probst F.J., Fridell R.A., Raphael Y., Saunders T.L., Wang A., Liang Y.,
RA   Morell R.J., Touchman J.W., Lyons R.H., Noben-Trauth K., Friedman T.B.,
RA   Camper S.A.;
RT   ;
RL   Submitted (10-MAR-1998) to the INSDC.
RL   Department of Human Genetics, The University of Michigan Medical School,
RL   4701E Medical Science Research Building III, 1500 W. Medical Center Drive,
RL   Ann Arbor, MI 48109-0638, USA
XX
DR   MD5; be2bf43676026481eaec28bbf2246420.
DR   Ensembl-Gn; ENSMUSG00000042678; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018419; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018388; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018358; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018359; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018172; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018811; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017729; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018146; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018255; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018246; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018328; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018270; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018852; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017500; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017780; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094135; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0029459; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0029411; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0029384; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0029401; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029200; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0029902; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0028885; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029116; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029261; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0029368; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029222; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0029938; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0028586; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0028690; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5351
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>5351
FT                   /codon_start=3
FT                   /gene="Myo15"
FT                   /product="unconventional myosin MYO15"
FT                   /db_xref="GOA:Q9QZZ4"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000857"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035487"
FT                   /db_xref="MGI:MGI:1261811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZZ4"
FT                   /protein_id="AAC40124.1"
FT                   /translation="GGDCHKSLWKKTRPQSWQNKMHSIRNLPSMRSREQHREDGVEDMT
FT                   QLEDLQETTVLANLKTRFERNLIYTYIGSILVSVNPYRMFAIYGPEQVQQYSGRALGEN
FT                   PPHLFAIANLAFAKMLDAKQNQCVIISGESGSGKTEATKLILRCLAAMNQRRDVMQQIL
FT                   EATPLLEAFGNAKTVRNDNSSRFGKFVEIFLEGGVICGAITSQYLLEKSRIVFQAKNER
FT                   NYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGKSDADDFRRLLAAMEVLG
FT                   FTSEDQDSIFRILASILHLGNVYFEKHETDAQEVASVVSAREIQAVAELLQVSPEGLQK
FT                   AITFKVTETIREKIFTPLTVESAVDARDAIAKVLYALLFGWLITRVNALVSPKQDTLSI
FT                   AILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYIREQMDWREIAFADN
FT                   QPCINLISLKPYGILRILDDQCCFPQATDHTFLQKCHYHHGANPLYSKPKMPLPEFTIK
FT                   HYAGKVTYQVHKFLDKNHDQVRQDVLDLFVHSRTRVVAHLFSSHAAQTAPPRLGKSSSI
FT                   TRLYKAHTVAAKFQQSLLDLVEKMERCNPLFVRCLKPNHKKEPGLFEPDVMMAQLRYSG
FT                   VLETVRIRKEGFPVRLPFQVFIDRYRCLVALKLNVPADGDMCVSLLSRLCTVTPDMYRV
FT                   GISKLFLKEHLHQLLESMRERVQNRAALTLQRYLRGFFIQRHFRSLRRKIILLQSRARG
FT                   FLARQRYQQMRQSLLKFRSLVHTYVNRRRYLKELSKREVVPVRHLEVPAEVAGLLQAAA
FT                   GLKLSSGPRVAVVRAPRLQAEPCVTLPLDINNYPMAKFIRCHFKEPSFGMLTVPLKMPL
FT                   TRLPVEHHAEAISVFKLIMRFMGDPHLHGTQEMILGNYIVHQGLVEPALRDEILAQLAN
FT                   QVWRNPNAYNSKRGWLLLAACPSGFAPSPHLDKFLLKFVSDYGQNGFQAVCQHRLLQAM
FT                   GSGAARTFPPTQLEWTAIQEKASMALDVSCFNGDQFSCPVHTWSTGEAVAGDILKHRGL
FT                   ADGWRGWTVAMKNGVQWAELAGHDYVLDLVSDLELLRDFPRQKSYFIVGAEGPLAGRGD
FT                   TRGVFGNCWDSDEDTPTRPQPQDHVAKMPDLDGYCSHKEDGTNGETEAQRWTSNRQAVD
FT                   SIGESTVPPRELDGYLDSLFDPVLACGDADLEKPTAIAYRMKGGGQPGGGGGSTSEDTS
FT                   RRPPEPKLKPIPGLDASTLALQQAFIHRQAVLLAREMTLQALALQQQPLSATSRPQLPE
FT                   RPLAPEARPKTVVGTGPPAKPVLVRPTPQSWAPGSVAKAPKIPSKPVAVPILAQDWTAP
FT                   ESISASPELVRYSTLNSEHFPQPTQQIRSIIKQYKQPPWAGHPEARRTDGGKVFRRPPD
FT                   PHEEALMILKGQKTQLAVVPGTQVSREAVAMVKPVTSAPRPCMGPTPVQPSRSLEPPED
FT                   PVQTQLHRLVNPNFYGYQDIPWRIFLRKEVFYPKDNYSHPVQLDLLFRQILHDTFSEAC
FT                   LRISEDERLQMKALFAQNQLDTQRPLVTESVKRAAISMARDSWEIYFSRLFPAMGSVGT
FT                   GVQILAVSHTGIKLLQMVKGSKEASRRLRVLCAYSFADILFVTMPSQNMLEFNLSNEKL
FT                   ILFSARAQQVKTLVDTFILELKKDSDYVVAVRNFLSEDPELLSFHKGDIIHLQSLEPTR
FT                   VGYSAGCVVRKKLVYLEELRRRGPDFGWRFGAVHGRVGRFPSELVQPAAAPDFLQLPAE
FT                   PGRGRAAAVAAAVASAAAAQEVGRRRE"
XX
SQ   Sequence 5351 BP; 1213 A; 1543 C; 1521 G; 1074 T; 0 other;
     atggaggtga ctgtcacaag agcctctgga aaaagactcg cccccaaagc tggcagaaca        60
     agatgcactc catacgcaac ctgccttcta tgcggtcccg tgagcagcac agggaagatg       120
     gagtggagga catgacgcag ctggaagacc tccaagagac cactgtgcta gccaacctaa       180
     agaccagatt tgagcgaaac ctcatctata cctatattgg cagtattctg gtgtcggtga       240
     acccatatcg aatgtttgca atctacgggc ctgagcaggt gcagcagtac agtgggcgtg       300
     ccctaggaga aaatcccccg cacctctttg caattgctaa tcttgccttc gccaaaatgc       360
     ttgatgccaa acagaaccag tgtgtcatca tcagtgggga gagtggctct ggaaagactg       420
     aggctacgaa actgattctg cgctgcctgg ctgccatgaa ccagagacgg gacgtcatgc       480
     agcagatcct ggaggcaacg cctctcctgg aggcctttgg taatgccaaa actgtcagga       540
     atgacaactc cagccgcttt gggaagtttg tggaaatctt tctagaaggg ggtgtgatct       600
     gtggtgccat aacctctcag tacctgctgg agaagtcaag gattgtgttc caggccaaaa       660
     atgaaagaaa ttatcatatt ttctatgagc tgctggctgg gctccctgct caactaagac       720
     aggccttcag cctgcaggag gctgagacct actactacct gaaccagggc gggaactgtg       780
     agatcgctgg aaagagtgac gcagatgact tccgccgtct gctggctgcg atggaggtgc       840
     ttggcttcac cagtgaggac caggacagca tcttccgaat cctagcctcc atcttacacc       900
     tgggcaatgt ctattttgag aaacatgaga ccgatgccca ggaggtggcc tcggtggtga       960
     gcgcccggga gatccaggct gtggcagagc tgcttcaggt ctctcctgag ggcctgcaga      1020
     aggctatcac cttcaaagtg actgagacaa ttcgagagaa gatcttcaca cccctaacag      1080
     tggagagtgc cgtagatgcc agggacgcca tcgccaaggt cttgtatgca ctgctgtttg      1140
     gctggctcat caccagggtc aacgctctgg tgtccccaaa acaagataca ttgtccatcg      1200
     ccatcttgga catatatggc tttgaggacc tgagcttcaa cagctttgaa caactgtgca      1260
     tcaactatgc caacgagaac cttcagtacc tgttcaacaa gatcgtcttc caggaggagc      1320
     aggaggagta catccgggag cagatggact ggagagagat tgcctttgct gacaaccagc      1380
     cctgcatcaa cctcatctcc ctgaagccct acggcatcct gcgcatcctg gatgaccagt      1440
     gctgctttcc ccaggccaca gaccacacat tcctgcagaa gtgccactac caccatggcg      1500
     ccaacccgct ctactctaag cctaagatgc cactgccaga gtttaccatc aagcactatg      1560
     caggcaaggt cacctaccag gtgcacaagt tcctggacaa gaaccatgac caagtgcgcc      1620
     aagacgtcct ggacttgttt gtgcacagcc gcacaagggt ggtagcacac cttttctcca      1680
     gccacgctgc gcagactgcc cctccacgcc tgggcaagag cagctccatt acccgtctct      1740
     acaaggctca cacggtggcg gccaagttcc agcagtccct cctggacctg gtggaaaaga      1800
     tggagaggtg taaccctttg ttcgtgcgct gcctgaagcc caaccataag aaggaacctg      1860
     gtctctttga gccagatgtg atgatggcac agttacgcta ttcaggggtt ctggagactg      1920
     tgaggatccg caaggaaggc tttccggtgc ggctaccctt ccaggtgttt atcgacaggt      1980
     accggtgcct ggtggccctc aagctcaacg tgccagcaga tggggacatg tgtgtgtcat      2040
     tgctgagccg gctatgcacg gtcactccag acatgtaccg tgttgggatt agcaagctct      2100
     tcctcaagga gcacctgcac cagctactgg agagcatgcg ggagcgagtc cagaaccgag      2160
     ctgccctcac cctgcagcgc tacctgcgag gttttttcat ccaacggcac ttccggtcct      2220
     tgcggcggaa gatcatccta ctgcagagca gagcccgtgg ttttctggcc agacaacgct      2280
     accagcagat gaggcagagt ctgctgaagt tccgttccct ggtgcacacc tacgtgaacc      2340
     gccgccgcta cctcaaggag ctgagcaagc gtgaagtggt cccagtgaga catctggagg      2400
     tgccagctga ggtggctggg ctcctgcaag ccgcagcagg cctcaagctg tccagtgggc      2460
     cccgagtggc tgttgtccgg gctcctaggc tccaggctga gccgtgtgtc acacttcccc      2520
     ttgacatcaa caactacccc atggccaagt tcattcgatg ccacttcaag gaaccctcct      2580
     ttgggatgct gacagtgccc ctgaagatgc ctctcacacg gctgcctgtg gagcaccacg      2640
     cagaagccat aagtgtcttt aagctaatca tgcgtttcat gggagacccc cacctgcatg      2700
     gcacccaaga gatgatcttg gggaactaca ttgtgcacca ggggctggtg gagccagctc      2760
     tgagggacga gatcctagcc cagctggcca accaggtgtg gcgcaatccc aatgcctaca      2820
     actccaagcg gggctggttg ctgttggctg cctgtcccag tggctttgcg ccttccccgc      2880
     accttgacaa gttcctcctc aagtttgtat ctgattatgg acagaatggc ttccaggctg      2940
     tgtgccagca tcgcctcctg caggcgatgg gctcaggggc tgcccggacc tttcccccaa      3000
     ctcagctgga gtggactgcc attcaggaga aggccagtat ggctctagat gtgagctgct      3060
     tcaatggtga ccagttctcc tgtccggtcc acacctggag tacgggggaa gcggtggctg      3120
     gagacatcct aaagcacagg gggctggctg atggttggag gggctggaca gtggccatga      3180
     agaatggagt ccagtgggca gagctggctg gacatgacta tgtgctggac ctggtatcag      3240
     acctggaact gctcagggac ttcccacgac agaaatctta cttcatagtg ggtgcagaag      3300
     ggcctttggc tggcagggga gacaccagag gagtgtttgg gaactgctgg gactcagacg      3360
     aggacacacc cacaaggccc cagccccagg accacgtggc caagatgcct gacttggatg      3420
     ggtactgcag ccacaaagag gatggtacaa atggagaaac tgaggcccag agatggacgt      3480
     cgaaccgcca agctgtggac agcattggag agtccactgt gccccccagg gagctggatg      3540
     gctacttgga cagtctcttc gaccctgtgc tggcctgtgg ggatgcggac ctggagaagc      3600
     cgacagccat cgcctaccgc atgaaaggtg ggggccagcc aggtggaggt ggtggcagta      3660
     cttctgaaga tacctcccgg agacccccgg aacccaagct caagcccatc ccaggcctgg      3720
     atgcctccac actggctctg cagcaagcct tcatccacag gcaggctgtg ctactggccc      3780
     gggagatgac cctgcaggct ttggcacttc agcagcagcc tctgagtgca acctcaagac      3840
     ctcagctccc agagagaccc ctagcaccag aggcacggcc gaagactgta gtaggcactg      3900
     gccccccagc caagcctgtg ctggtgcgtc cgactccaca gtcgtgggct ccgggctctg      3960
     tggcaaaggc cccgaagata cctagcaagc ccgtggctgt cccaatccta gctcaagatt      4020
     ggactgctcc agaatccatt tcggcttccc ctgagctggt tcggtattcc acactcaact      4080
     cagagcactt cccacaaccc acacagcaga tcagaagcat catcaagcaa tacaaacagc      4140
     caccctgggc aggacaccct gaggcccgca ggacggatgg tggaaaggtc ttcaggaggc      4200
     cacctgaccc ccatgaggag gccctaatga ttctgaaggg acagaagact caactagcag      4260
     tagtgcctgg cactcaggtg tccagagagg ctgtggccat ggtgaagccg gtgaccagtg      4320
     ctccaaggcc atgcatgggg cccactccag tgcagccttc aaggtcgctg gagcctccag      4380
     aggatcctgt gcagacacag ctgcaccgcc tagtcaaccc caacttctat ggctaccagg      4440
     acatcccctg gcggatcttc ctgcgcaagg aggtatttta ccccaaggac aactacagtc      4500
     accctgtgca gctagacctc ctgttccggc agatcctgca tgacacattc tccgaggctt      4560
     gcctgcgcat atctgaggat gagcggctgc agatgaaggc tctgtttgcc cagaaccagc      4620
     tggacacaca gcgacctctg gtaacagaaa gtgtgaagcg ggccgccatc agcatggccc      4680
     gagacagctg ggagatctac ttctctcgcc tcttcccggc aatgggcagt gttggcaccg      4740
     gcgtgcagat cctagctgtg tctcacactg gcatcaagct cctgcagatg gtcaagggca      4800
     gcaaggaggc cagcaggcgg ctccgcgtcc tgtgtgcata cagctttgca gacatcctgt      4860
     ttgtaaccat gccatctcag aacatgctag agttcaatct gtccaacgag aagctcatcc      4920
     tcttctcagc ccgggcgcag caggtcaaga ccctagtaga caccttcatt ctggaactga      4980
     agaaggattc tgattatgtt gtggcagtga ggaacttcct gtctgaagac cccgagctgc      5040
     tgtccttcca caagggtgac atcatccacc tgcagagcct ggaaccaact agagtgggct      5100
     acagcgccgg ttgtgtagtc cgcaagaaac tggtgtacct ggaggagctg aggcggagag      5160
     gccctgactt tggctggagg ttcggggccg tccacgggcg cgtaggacgt tttccttcag      5220
     agctcgtgca gcccgcagct gctccagact tcttgcagct cccggcagag ccagggcggg      5280
     gccgggctgc cgcggtggcc gccgctgtgg cctctgcagc agccgcacag gaggtggggc      5340
     gccggagaga g                                                           5351
//