Dbfetch

ID   AF048688; SV 1; linear; genomic DNA; STD; HUM; 306 BP.
XX
AC   AF048688;
XX
DT   13-MAR-1998 (Rel. 55, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-306
RA   Erne G., Schmid C., Schwarz K., Woelpl A.;
RT   ;
RL   Submitted (17-FEB-1998) to the INSDC.
RL   Transplantation Immunology, Red Cross Blood Bank Ulm, Helmholtzstr. 10, Ulm
RL   89081, Germany
XX
DR   MD5; 19adafe96445796691be8e8881fe3998.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..306
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="between D6S8 and D6S5"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <14..>283
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            14..283
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <14..>283
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:34"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAC05271.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEENLRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVGESFTVHRR"
XX
SQ   Sequence 306 BP; 61 A; 80 C; 112 G; 53 T; 0 other;
     cgtgtcccca cagcacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggttcct ggacagatac ttccataacc aggaggagaa cctgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacat cctggaagac gagcgggccg cggtggacac ctactgcaga       240
     cacaactacg gggttggtga gagcttcaca gtgcaccggc gacgtgagcg cggcgcgggg       300
     cggggc                                                                  306
//