Dbfetch

ID   AF045889; SV 1; linear; mRNA; STD; MUS; 1280 BP.
XX
AC   AF045889;
XX
DT   20-FEB-1998 (Rel. 54, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus putative DNA cytosine methyltransferase DNMT2 (Dnmt2) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1280
RX   DOI; 10.1093/nar/26.11.2536.
RX   PUBMED; 9592134.
RA   Okano M., Xie S., Li E.;
RT   "Dnmt2 is not required for de novo and maintenance methylation of viral DNA
RT   in embryonic stem cells";
RL   Nucleic Acids Res. 26(11):2536-2540(1998).
XX
RN   [2]
RP   1-1280
RA   Xie S., Okano M., Li E.;
RT   ;
RL   Submitted (04-FEB-1998) to the INSDC.
RL   CVRC, Mass. Gen. Hospital, 149 13th Street, Charlestown, MA 02129, USA
XX
DR   MD5; 4d407a90278241a9941221b2990c9c79.
DR   Ensembl-Gn; ENSMUSG00000026723; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124488; mus_musculus.
DR   EuropePMC; PMC147598; 9592134.
DR   EuropePMC; PMC151934; 12399478.
DR   EuropePMC; PMC18343; 10781108.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1280
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             25..1272
FT                   /codon_start=1
FT                   /gene="Dnmt2"
FT                   /product="putative DNA cytosine methyltransferase DNMT2"
FT                   /note="homolog to yeast pmt1"
FT                   /db_xref="GOA:O55055"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="MGI:MGI:1274787"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55055"
FT                   /protein_id="AAC40130.1"
FT                   /translation="MEPLRVLELYSGIGGMHHALRESHIPAHVVAAIDVNTVANEVYKH
FT                   NFPHTHLLSKTIEGISLEDFDKLSFNMILMSPPCQPFTRIGLQGDMTDPRTTSFLYILD
FT                   ILPRLQKLPKYILLENVKGFEVSSTRGLLIQTIEACGFQYQEFLLSPSSLGIPNSRLRY
FT                   SLIAKLQSEPFPFQAPGQILMEFPKIVTVEPQKYAVVEESQPRVQRTGPRICAESSSTQ
FT                   SSGKDTILFKLETVEERDRKHQQDSDLSVQMLKDFLEDGDTDEYLLPPKLLLRYALLLD
FT                   IVKPTSRRSMCFTKGYGSYIEGTGSVLQAAEDAQIENIYKSLPDLPPEEKIAKLSMLKL
FT                   RYFTPKEIANLQGFPPEFGFPEKTTVKQRYRLLGNSLNVHVVAKLLTVLCEGFGNASES
FT                   CHKMPLILDSNSKILS"
XX
SQ   Sequence 1280 BP; 377 A; 279 C; 284 G; 340 T; 0 other;
     gaattccggc gcggttgcga gaggatggaa cctctgcgtg tcctggagct gtacagtggc        60
     attggtggca tgcaccacgc gctgcgagaa agtcatatcc ctgcacatgt ggtggctgct       120
     attgatgtga atactgttgc taatgaagta tacaagcata attttcctca tactcactta       180
     ctgtcaaaga caattgaagg tatttcactg gaagactttg acaagctatc tttcaatatg       240
     attttaatga gccctccatg ccagccattc acaagaattg gcctacaggg ggatatgacc       300
     gatccaagga caactagctt cttgtatatt ctagatattc tcccaagatt acaaaaatta       360
     cccaagtata ttctcttaga aaatgtcaaa ggttttgaag tatcttctac aagagggctg       420
     ctgatacaaa caatagaagc ctgtggcttt cagtatcaag agtttctatt gtctccttct       480
     tctctaggca ttccaaactc gaggctccga tattctctca ttgcaaagct tcagtcagag       540
     cctttcccct tccaggcccc tggacagata ctgatggagt ttcctaaaat tgtaactgtt       600
     gagccacaaa aatatgcagt agttgaagaa agtcagccaa gagtgcagag aactggacca       660
     cgtatctgtg ctgagagcag cagcacacag agttctggaa aagataccat tctctttaag       720
     cttgagactg tagaagaaag ggacaggaaa catcaacaag acagtgacct ctctgtgcag       780
     atgctgaaag acttccttga agatggcgac acagatgagt accttttacc acccaagtta       840
     ttgctgcgat acgctctctt actagatatc gtgaagccca cgtccagaag gtccatgtgc       900
     tttacgaaag ggtatgggag ttacatagag gggacaggct ccgtgttaca ggctgcagag       960
     gatgcgcaga ttgagaatat ctacaaatct cttcctgatt tgccaccaga agaaaagata      1020
     gctaaattgt caatgcttaa actgcgatat ttcacaccga aagaaattgc aaatctccag      1080
     ggatttcctc cagaatttgg gtttcctgag aagacaacag tgaaacagcg ttaccggctg      1140
     cttggcaata gcctcaacgt gcatgtggta gcaaaactcc tcacagtcct gtgtgaagga      1200
     tttggaaatg cctctgagag ctgtcacaag atgccgctaa ttctagatag taattccaag      1260
     attctatctt gaatgaattc                                                  1280
//