spacer

EBI Dbfetch

ID   AF045692; SV 1; linear; mRNA; STD; MUS; 4247 BP.
XX
AC   AF045692;
XX
DT   13-MAR-1998 (Rel. 55, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus X-linked PEST-containing transporter (Xpct) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4247
RX   DOI; 10.1006/geno.1997.5173.
RX   PUBMED; 9545634.
RA   Debrand E., Heard E., Avner P.;
RT   "Cloning and localization of the murine Xpct gene: evidence for complex
RT   rearrangements during the evolution of the region around the Xist gene";
RL   Genomics 48(3):296-303(1998).
XX
RN   [2]
RP   1-4247
RA   Debrand E., Heard E., Avner P.;
RT   ;
RL   Submitted (11-FEB-1998) to the INSDC.
RL   Molecular Biology, Institut Pasteur, 25, rue du Docteur Roux, Paris 75724
RL   Cedex 15, France
XX
DR   MD5; f144188fdfdb01dd7204fee4e5f47e59.
DR   Ensembl-Gn; ENSMUSG00000033965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042664; mus_musculus.
DR   EuropePMC; PMC1797602; 17318265.
DR   EuropePMC; PMC2681075; 18468505.
DR   EuropePMC; PMC4061481; 24994998.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4247
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..174
FT                   /gene="Xpct"
FT   CDS             175..1872
FT                   /codon_start=1
FT                   /gene="Xpct"
FT                   /product="X-linked PEST-containing transporter"
FT                   /function="putative transmembrane transporter of mevalonate
FT                   or monocarboxylate"
FT                   /db_xref="GOA:O70324"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR030761"
FT                   /db_xref="MGI:MGI:1203732"
FT                   /db_xref="UniProtKB/Swiss-Prot:O70324"
FT                   /protein_id="AAC40078.1"
FT                   /translation="MALPSPASEEAEGPCQEANQEYQEPVCSPVPEPEPEPEPEPEPDP
FT                   EPVPVPPPEPQPEPEPQPLPDPAPLPELGFEAEPEPQPLPDPAPLPELGFEAEPVQEPE
FT                   PTPTVETRGTARGFQPPEGGFGWIVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNR
FT                   QVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATTGAAVAFIGLHTSSFTSSLSL
FT                   RYFTYGILFGCGCSFAFQPSLVILDHYFQRRLGLANGVVSAGSSIFSMSFPFLIKMLGD
FT                   KIKLAQTFQVLSTFMFVLTLLSLTYRPLLPSSQDTPSKRGAHTLRQRFLVQFRKYFNMR
FT                   VFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEDKFKEIKETWVLLVCIGATSGLGRLV
FT                   SGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMA
FT                   PIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGA
FT                   VILFFVPLMHQRMFKKEQRDSSKDKMLSHDPDPNGELLPGSPTPEEPI"
FT   3'UTR           1873..4247
FT                   /gene="Xpct"
FT   regulatory      4205..4210
FT                   /gene="Xpct"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 4247 BP; 975 A; 1228 C; 988 G; 1056 T; 0 other;
     ccccagtgga gtaatgtgga caggctggcc agctcgggcg ctgggaggag gaggaggcag        60
     ggtctcaggc agccgcggcg gcagtgctcg gagcggcagg agcagtagca gcagaaacaa       120
     gtaccagcca gacaacagct cctccggcaa gccacagtca gtcccctagc cgcgatggcg       180
     ctgccaagcc cggcgagcga ggaagctgag gggccctgtc aggaggcaaa ccaggaatat       240
     caggagccgg tgtgtagtcc tgtgcccgag ccggagccag agccggagcc cgaaccggag       300
     cctgaccccg agccggtgcc agtgcccccg cccgagcctc agcctgagcc cgagccccag       360
     cccctacccg atcctgcacc cctgccggag ctgggctttg aggctgagcc cgagccccag       420
     cccctacccg atcctgcacc cctgccggag ctgggctttg aggctgagcc agtgcaagaa       480
     cccgagccca cgcccactgt ggaaacccga ggcaccgcgc gtggctttca gcctcccgaa       540
     ggtggcttcg gctggatagt ggtgtttgca gccacctggt gcaacggctc catcttcggc       600
     atccataact ctgttggtat cctctactcc atgctactag aggaggaaaa agagaaaaat       660
     cgccaagtgg agttccaagc agcatgggtc ggagccctcg ctatgggcat gatcttcttc       720
     tgttctccca ttgtgagtat attcactgac cgtttgggct gccgaatcac agccaccacc       780
     ggggccgctg ttgctttcat tggcctccac accagctcct tcaccagctc cctaagcctg       840
     cgctacttca cctatgggat tctgtttggt tgtggctgct cattcgcctt tcaaccatca       900
     ctcgtcatcc tggaccacta ctttcaacgt cgcctaggtc tagccaatgg tgtggtatct       960
     gctggaagta gcatcttctc catgtctttt cccttcctca tcaaaatgct gggggataaa      1020
     atcaagctgg cccaaacctt ccaggtgctg agtaccttca tgtttgtcct tacgctgctc      1080
     tcactcactt accggcccct cctgccaagc tcccaggaca ccccaagcaa gagaggtgcc      1140
     cacaccctgc gacagcgctt tctggttcag ttcagaaagt acttcaacat gcgtgtattc      1200
     cgccagcgca cttaccgtat ctgggccttt gggatcgctg ctgctgccct tggttacttc      1260
     gtcccctacg tgcacctgat gaaatatgtg gaagataagt tcaaggagat caaggagacc      1320
     tgggtgctct tggtgtgcat tggggctacg tcaggcctcg gacgtctcgt ctcgggccac      1380
     atcagtgact ccatccctgg acttaagaag atatacttgc aggtcctctc attcctgctc      1440
     ctgggcttga tgtccatgat gatcccccta tgccgggact tcgggggcct tatcgttgtc      1500
     tgcctcttcc tgggcctatg tgatggcttc ttcattacca tcatggctcc cattgcattt      1560
     gagctggtgg gacccatgca ggcctcacag gccattggct acctcctggg catgatggcc      1620
     ctgccaatga ttgctgggcc ccccattgca ggcctccttc gaaactgctt tggtgattac      1680
     catgtggcct tctactttgc gggtgtcccc ccaatcattg gagctgtgat ccttttcttc      1740
     gtccctctga tgcatcaaag gatgtttaag aaagagcaga gagattccag caaggataag      1800
     atgctgtccc acgatccaga ccccaacgga gaactgctgc caggctcccc aacacctgaa      1860
     gagcccattt aatgcctctg tcttgccatt gtgtgctcct tccccccccc cccactccac      1920
     ccctcatcct accctgctta gcatttacat tttttgccac cagcacactt gttcccaaac      1980
     ctgtgcacac agcatttcag ccacctgacc atctcctctg agccaatgct ctcggtgttc      2040
     caaactcatt aaccaaattc tccccatgaa tgccttgaaa cttgccaggc tcttctccca      2100
     aaatctggga aagtgtggga tcaccccctg gcctttggat cctcccccat atatactttc      2160
     taactctttg cggggaggac agggatggga tctctagccc cagattgtta gtcacccact      2220
     acaatcaatt gccaaaggtg ctactgtgtc cccagaaccc agtgagacag acctaagcct      2280
     ctgtttgctg aggaatttgt tgccatccat ccttgggaac catttgggaa ttgtgagaag      2340
     gaaggccaaa ggagaccagg agccttgttt tgcatcgaag ctcctgagga ttctgcggca      2400
     ccccatcata tggttggtta gccgtctgct tcccttttcc tttcctagta ttttctctct      2460
     acttcctctt ctccgatttc ttcccctcta ttccttttta ttagtgtcat gacacatagg      2520
     tgcttggaga aaggaaagac ccagagcttg ggccaatcca cttcattctg acccagacca      2580
     tccctaatat tagcattaat actgctcatc tcaggttgag ctacatctca ctttctgggc      2640
     tcaaactgat atggactgga agagcaggct atcgcatagg gatgggaatc ttcaacacta      2700
     cagagttcca tgtaccagtc actgattttg acagattaac caagaggcct tcccagtttc      2760
     ccatccttcc cacctgtcaa atgtgaagaa acttttctca tttcatgaaa cacaggagga      2820
     aagatgtcag tgcactggca ttagaggaga tgctacggtt aacggtttgg ggaaggacca      2880
     actcctccgt ctctcatttt tcataagagg tcaatatttc cacctgggcc aggccaagaa      2940
     atgaactgct ttaaggaaaa aaaaaaaaac ctcattctgt acctggatct ccaaatgaca      3000
     taggcaacaa ctgcacgtag gggttggata atttcttttc agaaggggaa gccaccctag      3060
     cctttaccac ccacccagtc tgtcccccat tctaggcatc ctgaaccact ctgctgagtg      3120
     ggcattatag gtgccaaaaa aagtaggctc tggaccacca tcatcccttt gaagttggtg      3180
     ccaaatattt tcctacatcc aggctctggg caacagtctt actgaagcac attccaagtg      3240
     cccctggcca aaggcaaagg gcactgccag cctcgtccag ttgtacggct cacctcatta      3300
     gggactcagc ctctctcctc cctgtttctc tctctctctg tgtctctctc tctgtctttg      3360
     tttattgtgt tcctgtacca accttttatc atctttttgc caggcatcct ggctgttact      3420
     tggacccaac aataacttgc caccccaagc tagggtcatc ccaaggccag gaagatgagg      3480
     ttgctctgag gggctccaaa gaatacaatg gtccccacac atgagttttt ccgttactaa      3540
     caggcagctg gggcatagtt ggcctctgat gtttcattca aggccaaagt cctgagcccc      3600
     cctctgctgg tcccaatcca gctcttatca actccccaaa ggaaaaccca ttggttcttg      3660
     gctctgagga caggaagggg tggagtcact gtcctgtcaa ctcaagcatc tatggaacag      3720
     gagaagctgg gccccaggag ccctgcgact tcccaggaag aggccattga aaatactgaa      3780
     gcaacaatgc ttccacttcc atttctcctt accccacccc cttccaggcc atttaggggg      3840
     tagggggcag aataagtgtg cagggcttcc tttgttgctc atggctggac agctctaaag      3900
     agtcaggctg ccactcactt ttctccagat gatggaaaga cattcacagg tcccagattt      3960
     gcccattcag gtgtcaccta acattggcag ggtgtcaatt tactttttta tttttcacaa      4020
     atgcgtgtgt gcacgtgtgg gcttgtgtgc tttccgagag aatgttgttt ggccaaagca      4080
     gcacagtatt aatatttaga gtaggaagca gccttttagg caccacagtt aaaaactaag      4140
     agaacgaaca aaatttcaga gcttgagacc tgggacattt aaatcctcaa ggggtttgga      4200
     acaaaataaa cagatttaaa aaaaaaaaaa aaaaaaaaaa aaaaaaa                    4247
//


spacer
spacer