spacer

EBI Dbfetch

ID   AF045146; SV 1; linear; mRNA; STD; MUS; 1525 BP.
XX
AC   AF045146;
XX
DT   02-JUL-1998 (Rel. 56, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus chemokine receptor CXCR3 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1525
RX   DOI; 10.1073/pnas.95.14.8205.
RX   PUBMED; 9653165.
RA   Soto H., Wang W., Strieter R.M., Copeland N.G., Gilbert D.J., Jenkins N.A.,
RA   Hedrick J., Zlotnik A.;
RT   "The CC chemokine 6Ckine binds the CXC chemokine receptor CXCR3";
RL   Proc. Natl. Acad. Sci. U.S.A. 95(14):8205-8210(1998).
XX
RN   [2]
RP   1-1525
RA   Soto H., Zlotnik A.;
RT   ;
RL   Submitted (27-JAN-1998) to the INSDC.
RL   Immunobiology, DNAX Research Institute, 901 California Ave., Palo Alto, CA
RL   94304, USA
XX
DR   MD5; 3479d4f8b9b73221ccfcb3ac7fcdb2c9.
DR   Ensembl-Gn; ENSMUSG00000050232; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056614; mus_musculus.
DR   EuropePMC; PMC20954; 9653165.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1525
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1104
FT                   /codon_start=1
FT                   /product="chemokine receptor CXCR3"
FT                   /db_xref="GOA:O88410"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004070"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1277207"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88410"
FT                   /protein_id="AAC40163.1"
FT                   /translation="MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQD
FT                   FSLNFDRTFLPALYSLLFLLGLLGNGAVAAVLLSQRTALSSTDTFLLHLAVADVLLVLT
FT                   LPLWAVDAAVQWVFGPGLCKVAGALFNINFYAGAFLLACISFDRYLSIVHATQIYRRDP
FT                   RVRVALTCIVVWGLCLLFALPDFIYLSANYDQRLNATHCQYNFPQVGRTALRVLQLVAG
FT                   FLLPLLVMAYCYAHILAVLLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILMD
FT                   VGVLARNCGRKSHVDVAKSVTSGMGYMHCCLNPLLYAFVGVKFREKMWMLFTRLGRSDQ
FT                   RGPQRQPSSSRRESSWSETTEASYLGL"
XX
SQ   Sequence 1525 BP; 316 A; 433 C; 386 G; 390 T; 0 other;
     atgtaccttg aggttagtga acgtcaagtg ctagatgcct cggactttgc ctttcttctg        60
     gaaaacagca cctctcccta cgattatggg gaaaacgaga gcgacttctc tgactccccg       120
     ccctgcccac aggatttcag cctgaacttt gacagaacct tcctgccagc cctctacagc       180
     ctcctcttct tgctggggct gctaggcaat ggggcggtgg ctgctgtgct actgagtcag       240
     cgcactgccc tgagcagcac ggacaccttc ctgctccacc tggctgtagc cgatgttctg       300
     ctggtgttaa ctcttccatt gtgggcagtg gatgctgctg tccagtgggt tttcggccct       360
     ggcctctgca aagtggcagg cgccttgttc aacatcaact tctatgcagg ggccttcctg       420
     ctggcttgta taagcttcga cagatatctg agcatagtgc acgccaccca gatctaccgc       480
     agggaccccc gggtacgtgt agccctcacc tgcatagttg tatggggtct ctgtctgctc       540
     tttgccctcc cagatttcat ctacctatca gccaactacg atcagcgcct caatgccacc       600
     cattgccagt acaacttccc acaggtgggt cgcactgctc tgcgtgtact gcagctagtg       660
     gctggtttcc tgctgcccct tctggtcatg gcctactgct atgcccatat cctagctgtt       720
     ctgctggtct ccagaggcca gaggcgtttt cgagctatga ggctagtggt agtggtggtg       780
     gcagcctttg ctgtctgctg gaccccctat cacctggtgg tgctagtgga tatcctcatg       840
     gatgtgggag ttttggcccg caactgtggt cgaaaaagcc acgtggatgt ggccaagtca       900
     gtcacctcgg gcatggggta catgcactgc tgcctcaatc cgctgctcta tgcctttgtg       960
     ggagtgaagt tcagagagaa aatgtggatg ttgttcacgc gcctgggccg ctctgaccag      1020
     agagggcccc agcggcagcc gtcatcttca cggagagaat catcctggtc tgagacaact      1080
     gaggcctcct acctgggctt gtaattctgg actggaactg tagcctgcgc agcccaagtc      1140
     ctaacacact ccaagtgctt gtcctccttg tagttgggct agctcgaact tacccgtaac      1200
     tttgctgcca ggatgcactg acagctcagc atatatccag gtctcctgag aatcaatttc      1260
     agcaacaagg acaacaccat tactgtgcct tagctgccat gccctatctt gctgttttag      1320
     aactagctgc ctggagcccc accgccctac taaattagca agtagaactc agccatccct      1380
     gtgtgagaag agggagaggc aaatagcaca gagggccagg cgttgtcagc actgaatgtg      1440
     cccatctcag tatctcaata tttgcccaat tttatttcta gaaacctcac ttaaactttc      1500
     aataaacaag gtaatgaggg aaaaa                                            1525
//


spacer
spacer