spacer

EBI Dbfetch

ID   AF043342; SV 1; linear; mRNA; STD; HUM; 486 BP.
XX
AC   AF043342;
XX
DT   23-FEB-1998 (Rel. 54, Created)
DT   05-JUL-1999 (Rel. 60, Last updated, Version 2)
XX
DE   Homo sapiens tumor necrosis factor alpha (TNFa) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-486
RA   Jang J.S., Kim B.E.;
RT   ;
RL   Submitted (15-JAN-1998) to the INSDC.
RL   Protein Engineering, General Institute of Technology, Hyundai Pharm. Ind.
RL   Co., Ltd., 213 Sosa Bon 1-dong, Sosa-gu, Bucheon 422-231, Korea
XX
DR   MD5; d43a1177f724ace1e5358be8c392706e.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   EuropePMC; PMC3993425; 24566630.
DR   H-InvDB; HIT000063739_05.4.
DR   H-InvDB; HIT000063739_06.4.
DR   H-InvDB; HIT000063739_07.4.
DR   H-InvDB; HIT000063739_08.4.
DR   H-InvDB; HIT000063739_09.4.
DR   H-InvDB; HIT000063739_10.4.
DR   H-InvDB; HIT000063739_11.4.
XX
CC   forward primer (5'-ctcgagtcagatcatcttctcgcaccccg-3')
CC   reverse primer (5'-ggaattctgttcgtcctcctcacagggc-3').
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..486
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /cell_type="PHA-treated peripheral blood leukocyte"
FT                   /db_xref="taxon:9606"
FT   gene            <1..486
FT                   /gene="TNFa"
FT   CDS             <1..474
FT                   /codon_start=1
FT                   /gene="TNFa"
FT                   /product="tumor necrosis factor alpha"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="H-InvDB:HIT000063739_04.4"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="AAC03542.1"
FT                   /translation="VRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRD
FT                   NQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
FT                   TPRGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL"
FT   primer_bind     <1..24
FT                   /gene="TNFa"
FT                   /PCR_conditions="94C-1min, 50C-1min, 72C-3min, 30 cycles;
FT                   DeltaCycler II from Ericomp"
FT   primer_bind     complement(466..>486)
FT                   /gene="TNFa"
XX
SQ   Sequence 486 BP; 101 A; 160 C; 133 G; 92 T; 0 other;
     gtcagatcat cttctcgcac cccgagtgac aagcctgtag cccatgttgt agcaaaccct        60
     caagctgagg ggcagctcca gtggctgaac cgccgggcca atgccctcct ggccaatggc       120
     gtggagctga gagataacca gctggtggtg ccatcagagg gcctgtacct catctactcc       180
     caggtcctct tcaagggcca aggctgcccc tccacccatg tactcctcac ccacaccatc       240
     agccgcatcg ccgtctccta ccagaccaag gtcaacctcc tctctgccat caagagcccc       300
     tgccagaggg agaccccgag gggggctgag gccaagccct ggtatgagcc catctatctg       360
     ggaggggtct tccagctgga gaagggtgac cgactcagcg ctgagatcaa tcggcccgac       420
     tatctcgact ttgccgagtc tgggcaggtc tactttggga tcattgccct gtgaggagga       480
     cgaaca                                                                  486
//


spacer
spacer