Dbfetch

ID   AF043278; SV 1; linear; mRNA; STD; MUS; 2578 BP.
XX
AC   AF043278;
XX
DT   20-OCT-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus kappa3 related opioid receptor isoform C mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2578
RX   DOI; 10.1016/S0014-5793(98)01039-4.
RX   PUBMED; 9755860.
RA   Pan Y.X., Xu J., Wan B.L., Zuckerman A., Pasternak G.W.;
RT   "Identification and differential regional expression of KOR-3/ORL-1 gene
RT   splice variants in mouse brain";
RL   FEBS Lett. 435(1):65-68(1998).
XX
RN   [2]
RP   1-2578
RA   Pan Y.X., Xu J., Wan B.L., Zuckerman A., Pasternak G.W.;
RT   ;
RL   Submitted (16-JAN-1998) to the INSDC.
RL   Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York Ave., New
RL   York, NY 10021, USA
XX
DR   MD5; 81c53302394f37e5a6f38512a319ffe0.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027036; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027002; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026972; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027010; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026752; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026866; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026832; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025947; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026283; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184127; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059991; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059927; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059607; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060383; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059899; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059579; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059686; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059651; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058879; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2578
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             21..308
FT                   /codon_start=1
FT                   /product="kappa3 related opioid receptor isoform C"
FT                   /note="KOR3C; alternatively spliced"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAC64509.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRQHCALGRSLMNFTGSALKTL"
XX
SQ   Sequence 2578 BP; 556 A; 662 C; 651 G; 709 T; 0 other;
     tggctttgca gggtgacagc atggagtccc tctttcctgc cccattctgg gaggtcttgt        60
     atggcagcca ctttcaaggg aacctgtctc tcctaaatga gaccgtaccc catcacctgc       120
     tcctcaatgc tagccacagt gccttcctgc cccttggact caaggtcacc atcgtggggc       180
     tctacttggc tgtgtgcatc ggggggctcc tggggaactg cctcgtcatg tatgtcatcc       240
     tcagacaaca ttgtgcactt ggaagatctt tgatgaactt tacaggcagt gccctgaaaa       300
     ccctctgaga ggagtcttaa gagagactga ggagagaaga cagcatctct ctctcttgat       360
     tccttccaca aattcacatt caggcacacc aagatgaaga ctgctaccaa catttacata       420
     tttaatctgg cactggctga taccctggtc ttgctgacac tgcccttcca gggcacagac       480
     atccttctgg gcttctggcc atttgggaat gcactgtgca agacggtcat tgctatcgac       540
     tactacaaca tgtttaccag cactttcact ttgactgcca tgagtgtaga ccgttatgta       600
     gctatctgcc accctatccg tgcccttgat gttcggacat ccagtaaagc ccaggccgtt       660
     aatgtggcca tatgggccct ggcttcggtg gttggtgttc ctgttgccat catgggctca       720
     gcacaagtgg aggatgaaga gatcgagtgc ctggtggaga tccccgcccc tcaggactat       780
     tggggccctg tatttgccat ctgcatcttc cttttttcct tcatcatccc ggttctgatc       840
     atctctgtct gctacagcct catgattcga cgacttcgtg gtgtccggct gctttcaggc       900
     tcccgagaga aggaccggaa cctgcgacgc atcacacggc tggtactggt agttgtggct       960
     gtgtttgtgg gctgctggac acctgtgcag gtctttgtcc tggttcaagg actgggtgtt      1020
     cagccaggta gtgagactgc agtagccatt ctgcgcttct gcacagccct gggctatgtc      1080
     aacagttgtc tcaatcccat tctctatgct ttcttggatg agaacttcaa ggcctgcttt      1140
     agaaagttct gctgtgcttc tgccctgcac cgggagatgc aggtttctga tcgtgtgcgc      1200
     agcattgcca aggatgtagg ccttggttgc aagacctctg agacagtacc acggccggca      1260
     tgactaggcg tggacctgcc catggtgcct gtcagtccac agagcccatc tacacccaac      1320
     acggagctca cacaggtcac tgctctctag gttgaccctg aactgagcgt ctggggcctt      1380
     gaatggcttt tcttttggtt caggatgctc agtcctagag gaagaccttt tagcaccatg      1440
     ggacaggtca aagcatcaag gtggcctcca tggctctgtc agattaagtt tcctccctgg      1500
     tataggacca gagagaacca aaggaactgc atggaaacat ccacaactca gtggacatgc      1560
     ctggtgaacc catgtaggta ttcatggttc acttgactct tctctggttt ctccctgctg      1620
     ccctggttct aggtgggctc agctgaggta ttgtagttgt catgtagtca ctattgtgac      1680
     tacctgttgt gtgctattgc cctcagcctt cagtgtttgc acagaactgg tgatcatacc      1740
     cagtgttgcc tggcccttaa gcttggagtt gccttggagc atctagttct gactccactg      1800
     atgcattcag attacctgag gtgggtgagc atcagtgggt tcttggatga ctgtttcctg      1860
     acgattcttt tcatgctgta ctatggtgta tatgaagggg acttcacact tcatctggta      1920
     ctgccactgc ctgctctacc aacctggacc accttctcag caagaggcta gcagggggac      1980
     aagacacaaa gcttccctaa ggctctttcc ctccaaaacc actgtgaact cttattctac      2040
     agactgtttg gcaagccctg cttctaactg tgtgggaagt aatcaggaga aaattctgtg      2100
     gcctctgtag gctgctcaca gcatggaggc accacatgct ggtcttgggt atgtgtcttg      2160
     gctgctcagt atgggcaggg cagggcacga gactatctct ctccttattc tccacagcct      2220
     ccctcagctc tccagcagtc gctcttttac ttgacagtag aggttagcag cagttgtact      2280
     cgtagaaaca cacttgtagc ccgggaagac tggagtcagg atgtgttcta ttctataccc      2340
     acagtgacca cctgcttcat ttatagggtt aggacatatc caagcaaggc ctgggcttgg      2400
     catcaaatga agagctggta tgagagctga agcctaaaat ggctcatttg agcaatctgc      2460
     aaggactatt acggttttgg ggacattgga agaagagtcg ataccttgga gatatattgt      2520
     tggttcacag aagaagaggc tttgtaaatg ccctttctat gggtcagata aaaaaaaa        2578
//