Dbfetch

ID   AF043277; SV 1; linear; mRNA; STD; MUS; 1257 BP.
XX
AC   AF043277;
XX
DT   20-OCT-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus kappa3 related opioid receptor isoform B mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1257
RX   DOI; 10.1016/S0014-5793(98)01039-4.
RX   PUBMED; 9755860.
RA   Pan Y.X., Xu J., Wan B.L., Zuckerman A., Pasternak G.W.;
RT   "Identification and differential regional expression of KOR-3/ORL-1 gene
RT   splice variants in mouse brain";
RL   FEBS Lett. 435(1):65-68(1998).
XX
RN   [2]
RP   1-1257
RA   Pan Y.X., Xu J., Wan B.L., Zuckerman A., Pasternak G.W.;
RT   ;
RL   Submitted (16-JAN-1998) to the INSDC.
RL   Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York Ave., New
RL   York, NY 10021, USA
XX
DR   MD5; eb879a32ade535896267b20c46b33f75.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027036; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027002; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0026972; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027010; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026752; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0026729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0026866; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0026832; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0026968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025947; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026283; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183693; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184127; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0059991; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0059927; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059607; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060383; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059899; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0059579; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0059686; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0059667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0059797; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059651; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058879; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1257
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             21..356
FT                   /codon_start=1
FT                   /product="kappa3 related opioid receptor isoform B"
FT                   /note="KOR3B; alternatively spliced"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAC64508.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRQCPENPLRGVLRETEERRQHLSLLIPSTN
FT                   SHSGTPR"
XX
SQ   Sequence 1257 BP; 241 A; 349 C; 325 G; 342 T; 0 other;
     tggctttgca gggtgacagc atggagtccc tctttcctgc cccattctgg gaggtcttgt        60
     atggcagcca ctttcaaggg aacctgtctc tcctaaatga gaccgtaccc catcacctgc       120
     tcctcaatgc tagccacagt gccttcctgc cccttggact caaggtcacc atcgtggggc       180
     tctacttggc tgtgtgcatc ggggggctcc tggggaactg cctcgtcatg tatgtcatcc       240
     tcaggcagtg ccctgaaaac cctctgagag gagtcttaag agagactgag gagagaagac       300
     agcatctctc tctcttgatt ccttccacaa attcacattc aggcacacca agatgaagac       360
     tgctaccaac atttacatat ttaatctggc actggctgat accctggtct tgctgacact       420
     gcccttccag ggcacagaca tccttctggg cttctggcca tttgggaatg cactgtgcaa       480
     gacggtcatt gctatcgact actacaacat gtttaccagc actttcactt tgactgccat       540
     gagtgtagac cgttatgtag ctatctgcca ccctatccgt gcccttgatg ttcggacatc       600
     cagtaaagcc caggccgtta atgtggccat atgggccctg gcttcggtgg ttggtgttcc       660
     tgttgccatc atgggctcag cacaagtgga ggatgaagag atcgagtgcc tggtggagat       720
     ccccgcccct caggactatt ggggccctgt atttgccatc tgcatcttcc ttttttcctt       780
     catcatcccg gttctgatca tctctgtctg ctacagcctc atgattcgac gacttcgtgg       840
     tgtccggctg ctttcaggct cccgagagaa ggaccggaac ctgcgacgca tcacacggct       900
     ggtactggta gttgtggctg tgtttgtggg ctgctggaca cctgtgcagg tctttgtcct       960
     ggttcaagga ctgggtgttc agccaggtag tgagactgca gtagccattc tgcgcttctg      1020
     cacagccctg ggctatgtca acagttgtct caatcccatt ctctatgctt tcttggatga      1080
     gaacttcaag gcctgcttta gaaagttctg ctgtgcttct gccctgcacc gggagatgca      1140
     ggtttctgat cgtgtgcgca gcattgccaa ggatgtaggc cttggttgca agacctctga      1200
     gacagtacca cggccggcat gactaggcgt ggacctgccc atggtgcctg tcagtcc         1257
//