spacer

EBI Dbfetch

ID   AF043276; SV 1; linear; mRNA; STD; MUS; 2634 BP.
XX
AC   AF043276;
XX
DT   20-OCT-1998 (Rel. 57, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus kappa3 related opioid receptor isoform A mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2634
RX   DOI; 10.1016/S0014-5793(98)01039-4.
RX   PUBMED; 9755860.
RA   Pan Y.X., Xu J., Wan B.L., Zuckerman A., Pasternak G.W.;
RT   "Identification and differential regional expression of KOR-3/ORL-1 gene
RT   splice variants in mouse brain";
RL   FEBS Lett. 435(1):65-68(1998).
XX
RN   [2]
RP   1-2634
RA   Pan Y.X., Xu J., Wan B.L., Zuckerman A., Pasternak G.W.;
RT   ;
RL   Submitted (16-JAN-1998) to the INSDC.
RL   Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York Ave., New
RL   York, NY 10021, USA
XX
DR   MD5; 6762a3a9bb605a4e9216e27bed2e77c7.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2634
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             299..598
FT                   /codon_start=1
FT                   /product="kappa3 related opioid receptor isoform A"
FT                   /note="KOR3A; alternatively spliced"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAC64507.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILSWEGIEGNWRQQAHQDEDCYQHLHI"
XX
SQ   Sequence 2634 BP; 544 A; 686 C; 679 G; 725 T; 0 other;
     tttggcttcc ttctccaacc tgcgcagccc ctccttctct cagccgcagc cttctgcccc        60
     tcccccttct ggctgccgca ctggctgctg cgtctagtca atatcttatc ttcggagcag       120
     gagctaggag ccattcccag ccggagcaga ccccaagcta gagtgagaag cattactcag       180
     ttcattgtgc tcctgcctgc ctttctgcta agcattaggg tctgttttgg cccagcttct       240
     gaagaggttg tgtgtgctgt tggaggaact gtactgagtg gctttgcagg gtgacagcat       300
     ggagtccctc tttcctgccc cattctggga ggtcttgtat ggcagccact ttcaagggaa       360
     cctgtctctc ctaaatgaga ccgtacccca tcacctgctc ctcaatgcta gccacagtgc       420
     cttcctgccc cttggactca aggtcaccat cgtggggctc tacttggctg tgtgcatcgg       480
     ggggctcctg gggaactgcc tcgtcatgta tgtcatcctc agctgggagg gcattgaggg       540
     gaactggaga cagcaggcac accaagatga agactgctac caacatttac atatttaatc       600
     tggcactggc tgataccctg gtcttgctga cactgccctt ccagggcaca gacatccttc       660
     tgggcttctg gccatttggg aatgcactgt gcaagacggt cattgctatc gactactaca       720
     acatgtttac cagcactttc actttgactg ccatgagtgt agaccgttat gtagctatct       780
     gccaccctat ccgtgccctt gatgttcgga catccagtaa agcccaggcc gttaatgtgg       840
     ccatatgggc cctggcttcg gtggttggtg ttcctgttgc catcatgggc tcagcacaag       900
     tggaggatga agagatcgag tgcctggtgg agatccccgc ccctcaggac tattggggcc       960
     ctgtatttgc catctgcatc ttcctttttt ccttcatcat cccggttctg atcatctctg      1020
     tctgctacag cctcatgatt cgacgacttc gtggtgtccg gctgctttca ggctcccgag      1080
     agaaggaccg gaacctgcga cgcatcacac ggctggtact ggtagttgtg gctgtgtttg      1140
     tgggctgctg gacacctgtg caggtctttg tcctggttca aggactgggt gttcagccag      1200
     gtagtgagac tgcagtagcc attctgcgct tctgcacagc cctgggctat gtcaacagtt      1260
     gtctcaatcc cattctctat gctttcttgg atgagaactt caaggcctgc tttagaaagt      1320
     tctgctgtgc ttctgccctg caccgggaga tgcaggtttc tgatcgtgtg cgcagcattg      1380
     ccaaggatgt aggccttggt tgcaagacct ctgagacagt accacggccg gcatgactag      1440
     gcgtggacct gcccatggtg cctgtcagtc ctagaggaag accttttagc accatgggac      1500
     aggtcaaagc atcaaggtgg cctccatggc tctgtcagat taagtttcct ccctggtata      1560
     ggaccagaga gaaccaaagg aactgcatgg aaacatccac aactcagtgg acatgcctgg      1620
     tgaacccatg taggtattca tggttcactt gactcttctc tggtttctcc ctgctgccct      1680
     ggttctaggt gggctcagct gaggtattgt agttgtcatg tagtcactat tgtgactacc      1740
     tgttgtgtgc tattgccctc agccttcagt gtttgcacag aactggtgat catacccagt      1800
     gttgcctggc ccttaagctt ggagttgcct tggagcatct agttctgact ccactgatgc      1860
     attcagatta cctgaggtgg gtgagcatca gtgggttctt ggatgactgt ttcctgacga      1920
     ttcttttcat gctgtactat ggtgtatatg aaggggactt cacacttcat ctggtactgc      1980
     cactgcctgc tctaccaacc tggaccacct tctcagcaag aggctagcag ggggacaaga      2040
     cacaaagctt ccctaaggct ctttccctcc aaaaccactg tgaactctta ttctacagac      2100
     tgtttggcaa gccctgcttc taactgtgtg ggaagtaatc aggagaaaat tctgtggcct      2160
     ctgtaggctg ctcacagcat ggaggcacca catgctggtc ttgggtatgt gtcttggctg      2220
     ctcagtatgg gcagggcagg gcacgagact atctctctcc ttattctcca cagcctccct      2280
     cagctctcca gcagtcgctc ttttacttga cagtagaggt tagcagcagt tgtactcgta      2340
     gaaacacact tgtagcccgg gaagactgga gtcaggatgt gttctattct atacccacag      2400
     tgaccacctg cttcatttat agggttagga catatccaag caaggcctgg gcttggcatc      2460
     aaatgaagag ctggtatgag agctgaagcc taaaatggct catttgagca atctgcaagg      2520
     actattacgg ttttggggac attggaagaa gagtcgatac cttggagata tattgttggt      2580
     tcacagaaga agaggctttg taaatgccct ttctatgggt cagataaaaa aaaa            2634
//


spacer
spacer