spacer

EBI Dbfetch

ID   AF042784; SV 1; linear; genomic DNA; STD; MUS; 2234 BP.
XX
AC   AF042784;
XX
DT   24-SEP-1998 (Rel. 57, Created)
DT   24-SEP-1998 (Rel. 57, Last updated, Version 1)
XX
DE   Mus musculus galanin receptor type 2 (GalR2) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2234
RA   Kolakowski L.F.Jr., Broussard S.R.;
RT   "Galanin Receptor Type 2 (GalR2) from Human and Mouse: Genomic Cloning,
RT   Chromosomal Localization, Functional Expression, Gq Dependent Signal
RT   Transduction, and Expression Pattern";
RL   Unpublished.
XX
RN   [2]
RP   1-2234
RA   Kolakowski L.F.Jr., O'Neill G.P., Howard A.D., Broussard S.R.,
RA   Sullivan K.A., Feighner S.D., Sawzdargo M., Nguyen T., Kargman S.,
RA   Shiao L.-L., Hreniuk D.L., Tan C.P., Evans J., Abramovitz M.,
RA   Chateauneuf A., Coulombe N., Ng G., Johnson M.P., Tharian A., Khosbeui H.,
RA   George S.R., Smith R.G., O'Dowd B.F.;
RT   ;
RL   Submitted (14-JAN-1998) to the INSDC.
RL   Department of Pharmacology, University of Texas Health Science Center at
RL   San Antonio, 7703 Floyd Curl Drive, San Antonio, TX 78284, USA
XX
DR   MD5; fe6d3114eb900f12342a609b416c9c4a.
DR   Ensembl-Gn; ENSMUSG00000020793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055872; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2234
FT                   /organism="Mus musculus"
FT                   /strain="129/SV"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="Stratagene catalog number 946309"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<24..388,1449..>2199)
FT                   /gene="GalR2"
FT                   /product="galanin receptor type 2"
FT   CDS             join(24..388,1449..2199)
FT                   /codon_start=1
FT                   /gene="GalR2"
FT                   /product="galanin receptor type 2"
FT                   /db_xref="GOA:O88854"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000405"
FT                   /db_xref="InterPro:IPR003907"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1337018"
FT                   /protein_id="AAC36589.1"
FT                   /translation="MNGSDSQGAEDSSQEGGGGWQPEAVLVPLFFALIFLVGAVGNALV
FT                   LAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLI
FT                   FLTMHASSFTLAAVSLDRYLAIRYPMHSRELRTPRNALAAIGLIWGLALLFSGPYLSYY
FT                   SQSQLANLTVCHPAWSAPRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAA
FT                   GSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSY
FT                   ANSCVNPIVYALVSKHFRKGFRKICAGLLRRAPRRASGRVCILAPGNHSGGMLEPESTD
FT                   LTQVSEAAGPLVPAPALPNCTTLSRTLDPAC"
XX
SQ   Sequence 2234 BP; 441 A; 655 C; 611 G; 527 T; 0 other;
     gccctttcca ctttggtgat accatgaatg gctcggacag ccagggggcg gaggactcga        60
     gccaggaagg tggcggcggc tggcagcccg aggcggtcct cgtaccccta tttttcgcgc       120
     tcatcttcct cgtgggcgct gtgggcaacg cgctggtgct ggcggtgctg ctgcgcggcg       180
     gccaggcggt cagcaccacg aacctattca tcctcaacct gggtgtggcc gacctgtgtt       240
     tcatcctgtg ctgcgtgcct ttccaggcca ccatctatac cctggacgat tgggtgtttg       300
     gctcactgct ctgcaaggcc gttcatttcc tcatcttcct cactatgcac gccagcagct       360
     tcacgctggc cgctgtctcg ctggacaggt gagtgaacat tctgtggtgt ctgagaactg       420
     ggtacccagg taggagcttg cactggagtc gccacgcaag gatccagaag ggatgcgtag       480
     tcggggagaa cactaaaatt acaaagtggc ccgaggccgt gaaacgcaag gggaaagggg       540
     actaagactc cgtgactaag agtgtccctt gattaagtcg gtcctcagac ctcgaaggct       600
     ggagaaatcg gatttctggg gtctttacgt tattgttgct tgagctaaaa gtctctcaga       660
     aacattgcag tactcagacc agagttggct tgcaaagtaa cttgccagta ttcaaatgct       720
     aattgagagc tgcagagagg catttgcttc ttggccccaa gctcagcacc tggagcgttg       780
     tccggcttta ggcttaggac tgagctgtac tttggataga cccatgctga agtccaaggc       840
     agcgggagtg agggctccta gcggacgtct aaagccttcc aggccaaggc tccccgcccg       900
     gagacgcctg cggtttgatg ttccttccct agctaaagga cccagaaaga gaaacttcca       960
     gaatgctctg aaggactcgt gactggaaaa gacactagaa acaggtcctg ggaaggatgt      1020
     cattagttcc ctgccccttc gcatcacttg gcccttccca cagtagagcg gtgaagagag      1080
     gcggagatcc tcattctctg ctttccactg agtgcaacat gtgggttctg agtccgctgg      1140
     tgggacgcac aaaacttcag ctttcttcag ggatttcctt gctctaccca agtcttctcc      1200
     gggttgtctg tcagagagcc tcaggcatta gagatttgtc tccctcggtt gtcacaagag      1260
     gataataatc actgccccca gaagtcctgg catattctac aacttttagt tttcggtggt      1320
     ttggggatgc cctttcgcgt ggtaggtcag tggccacatt ctcagggttg gtaatggtct      1380
     agcagtgaat tagtgaatcc tttcgcttac ctgtcgtcgt cgtccccccc gccccactgt      1440
     ccactcaggt atctggccat ccgctacccg atgcactccc gagagttgcg cacacctcga      1500
     aacgcgctgg cggccatcgg gctcatctgg gggctagcac tgctcttctc cgggccctac      1560
     ctgagctact acagtcagtc gcagctggcc aatctgacgg tgtgccaccc agcgtggagc      1620
     gcaccacgac gtcgcgccat ggacctctgc acttttgtct ttagctacct gttgccagtg      1680
     ctggtgctca gcctgaccta tgcgcgcacc ctgcactacc tctggcgcac agttgaccca      1740
     gtagctgcag gctcaggttc ccagcgcgcc aagcgcaagg tgacacggat gatcgtcatc      1800
     gtggcggtac tcttctgcct ctgttggatg ccccaccacg cgcttatcct ctgcgtgtgg      1860
     tttggtcgct ttccgctcac gcgtgccact tacgccctgc gcatcctttc acatctagta      1920
     tcttatgcca actcgtgtgt caaccccatc gtttatgctc tggtctccaa gcatttccgc      1980
     aaaggtttcc gcaaaatctg cgcgggcctg ctacgccgtg ccccgaggag agcttcaggc      2040
     cgagtgtgca tcctggcgcc tggaaaccat agtggtggca tgctggaacc tgagtccaca      2100
     gacctgacac aggtgagcga ggcagccggg cccctcgtcc ccgcacccgc acttcccaac      2160
     tgcacaacct tgagtagaac cctcgatcca gcctgttaaa ggaccaaagg gcatctaaca      2220
     gcttctaagg gcga                                                        2234
//


spacer
spacer