Dbfetch

ID   AF041211; SV 1; linear; mRNA; STD; MUS; 210 BP.
XX
AC   AF041211;
XX
DT   20-JAN-1998 (Rel. 54, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus natriuretic peptide receptor B type mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-210
RA   Schoenfeld J.R., Lowe D.G.;
RT   ;
RL   Submitted (05-JAN-1998) to the INSDC.
RL   Cardiovascular Research, Genentech, 1 DNA Way, South San Francisco, CA
RL   94080, USA
XX
DR   MD5; 36a8c764912d559ffa343a6fc42223d5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..210
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>210
FT                   /codon_start=1
FT                   /product="natriuretic peptide receptor B type"
FT                   /note="mNPR-B; GC-B"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:97372"
FT                   /db_xref="UniProtKB/TrEMBL:O55009"
FT                   /protein_id="AAB97013.1"
FT                   /translation="HFNWTARAALLYLDARTDDRPHYFTIEGVFEALQGSNLSVQHQVY
FT                   AREPGGPEQATHFIRANGRIVYICG"
XX
SQ   Sequence 210 BP; 41 A; 66 C; 60 G; 43 T; 0 other;
     cacttcaatt ggacggctcg ggctgctttg ctgtatctgg atgctcgcac agatgaccgg        60
     ccccactact tcaccatcga gggcgtcttt gaggccctgc agggcagcaa cctcagtgtg       120
     cagcaccagg tgtatgcccg agagccaggt ggccctgagc aagccaccca cttcatcaga       180
     gccaacgggc gcattgtgta tatctgcggc                                        210
//