Dbfetch

ID   AF040746; SV 1; linear; mRNA; STD; MUS; 2072 BP.
XX
AC   AF040746;
XX
DT   06-APR-1998 (Rel. 55, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus G protein-coupled receptor kinase 5 (GRK5) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2072
RX   DOI; 10.1074/jbc.274.41.29381.
RX   PUBMED; 10506199.
RA   Premont R.T., Macrae A.D., Aparicio S.A., Kendall H.E., Welch J.E.,
RA   Lefkowitz R.J.;
RT   "The GRK4 subfamily of G protein-coupled receptor kinases. Alternative
RT   splicing, gene organization, and sequence conservation";
RL   J Biol Chem 274(41):29381-29389(1999).
XX
RN   [2]
RP   1-2072
RA   Premont R.T., Lefkowitz R.J.;
RT   "Genomic Organization of the GRK5 and GRK6 Genes: Conserved Structure Among
RT   the GRK4 Subfamily of G Protein-coupled Receptor Kinases and Evolution of
RT   the GRK Gene Family";
RL   Unpublished.
XX
RN   [3]
RP   1-2072
RA   Premont R.T., Lefkowitz R.J.;
RT   ;
RL   Submitted (05-JAN-1998) to the INSDC.
RL   Medicine (Cardiology), Duke University Medical Center, Durham, NC 27710,
RL   USA
XX
DR   MD5; 2dfbbc614e265ceed797c63d965f2762.
DR   Ensembl-Gn; ENSMUSG00000003228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003313; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2072
FT                   /organism="Mus musculus"
FT                   /chromosome="19"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             242..2014
FT                   /codon_start=1
FT                   /gene="GRK5"
FT                   /product="G protein-coupled receptor kinase 5"
FT                   /db_xref="GOA:Q8VEB1"
FT                   /db_xref="InterPro:IPR000239"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:109161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VEB1"
FT                   /protein_id="AAC09267.1"
FT                   /translation="MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDL
FT                   RRTIDRDYYSLCDKQPIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKE
FT                   IMTKYLTPKSPVFIAQVGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLD
FT                   SMYFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRI
FT                   KKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNP
FT                   GFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGD
FT                   LIRGRVGTVGYMAPEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDR
FT                   RVLETEEVYSSKFSEEAKSICNMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEA
FT                   GMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIE
FT                   TECFKELNVFGPNGTLSPDLNRSQPPEPPKKGLFHRLFRRQHQSNSKSSPTPKTSCNHR
FT                   INSNHINSNSTGSS"
XX
SQ   Sequence 2072 BP; 565 A; 497 C; 581 G; 429 T; 0 other;
     gaaagtgttg agggaggggg gaggggggac acagagggag gaagaagcgg cggcggcgtc        60
     tcttcggtgc agagggggga aactccgcgg gctccgagaa agaataatgc ggtagcaggc       120
     aggctgcttg ctctggggtt tggcagcagc ggcggcagct cgagcagcgg cagcggcagc       180
     ggcatcaccc cagacgctga cagcacagcc ggccggctcc ctcgctgact gccgactgtc       240
     aatggagctg gaaaacatcg tggccaacac ggtcttgctg aaagcccggg aagggggtgg       300
     aggaaagcgc aaagggaaaa gcaagaagtg gaaggaaatc ctgaagtttc ctcacatcag       360
     ccagtgtgaa gacctccgaa ggaccataga cagagattac tacagtctat gtgacaagca       420
     accaattggg agactgcttt ttcgacagtt ctgtgaaacc aggcctgggc tggagtgcta       480
     cattcagttc ctggacttag tggcagaata tgaaattact ccagatgaaa accttggggc       540
     gaaggggaag gaaataatga ccaagtacct cactccaaag tccccagtct tcattgccca       600
     agttggacag gacctggtct cccagacaga gaagaagctc ctgcagagcc cctgcaaaga       660
     actcttctct gcttgtgctc agtctgtcca tgactacttg aagggagacc ccttccacga       720
     gtacctggat agcatgtatt ttgaccgttt tctgcagtgg aaatggttag aaagacaacc       780
     agtgaccaaa aacactttcc ggcagtaccg agtgctgggc aaagggggct ttggagaggt       840
     ctgtgcctgc caggttcggg ccactggtaa aatgtatgct tgtaaacgct tagagaagaa       900
     gaggatcaaa aagaggaaag gcgaatccat ggcactcaac gaaaagcaga ttcttgagaa       960
     ggtcaacagc cagtttgtgg tcaacctggc ctatgcctat gaaaccaaag atgcactatg      1020
     cctggttctg accattatga atggtggtga cctgaagttt cacatctaca atatggggaa      1080
     tcctggcttt gaggaagagc gagccttatt ttatgcagct gagatcctct gtggcctaga      1140
     agacttacac cgtgagaaca ctgtctatag agatctaaaa cccgaaaaca tcttgctgga      1200
     tgattatggc cacataagga tctcagacct cggactggcc gtgaagatcc ccgagggaga      1260
     ccttatccgt ggccgggtag gcactgttgg ctacatggcc ccagaagttc tgaacaacca      1320
     gcgatatgga ctgagccctg actactgggg cctgggctgc ctcatctatg agatgattga      1380
     aggccagtca ccatttcgag gtcgcaagga gaaggttaag cgggaagagg tggatcgccg      1440
     ggtgctggag actgaggaag tatattcctc caagttctct gaagaggcca agtccatctg      1500
     caacatgctg ctcaccaaag actcgaagca gaggctgggc tgccaggagg agggggccgc      1560
     cgaggtcaag aggcaccctt tcttcaggaa catgaacttt aagcgcctgg aggctgggat      1620
     gttggaccct cccttcgttc cagatccccg ggctgtatac tgcaaggatg tgctggacat      1680
     tgagcagttc tccactgtga aaggtgtcaa cctggaccat acggacgatg atttttactc      1740
     aaagttctct acaggctctg tgccaattcc atggcaaaat gagatgatag aaacagaatg      1800
     tttcaaggag ctgaatgtgt tcggacctaa cggtaccctc tcaccagacc tgaacagaag      1860
     tcagcctcca gaaccgccaa agaaagggct gttccacaga ctcttcaggc gtcagcatca      1920
     aagcaattcc aagagttcac ctactcctaa gaccagttgt aaccaccgaa taaattcaaa      1980
     ccacatcaat tcaaactcca ctggaagcag ctagtttcgg ctctggcctt gaagtcaaaa      2040
     gtggaaccag ctcagagcct tctactttga ag                                    2072
//