Dbfetch

ID   AF035579; SV 1; linear; mRNA; STD; MUS; 932 BP.
XX
AC   AF035579;
XX
DT   11-FEB-1998 (Rel. 54, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus cerberus homolog (Cer-1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-932
RX   DOI; 10.1006/dbio.1997.8812.
RX   PUBMED; 9501024.
RA   Biben C., Stanley E., Fabri L., Kotecha S., Rhinn M., Drinkwater C.,
RA   Lah M., Wang C.-C., Nash A., Hilton D., Ang S.-L., Mohun T., Harvey R.P.;
RT   "Murine cerberus homologue mCer-1: a candidate anterior patterning
RT   molecule";
RL   Dev. Biol. 194(2):135-151(1998).
XX
RN   [2]
RP   1-932
RA   Stanley E., Gilbert D.G., Jenkins N.A., Copeland N.G., Harvey R.P.;
RT   "Murine cerberus homolog Cer-1 maps to chromosome 4";
RL   Unpublished.
XX
RN   [3]
RP   1-932
RA   Stanley E., Biben C., Harvey R.P.;
RT   ;
RL   Submitted (24-NOV-1997) to the INSDC.
RL   Dev. & Neuro. Biol., Walter and Eliza Hall Institute of Medical Research,
RL   Royal Melbourne Hospital, Parkville, Victoria 3050, Australia
XX
DR   MD5; da6698a1fa6169cbddb233bbe3c5e296.
DR   Ensembl-Gn; ENSMUSG00000038192; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0028400; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0028361; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0028310; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0028381; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028096; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028820; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027537; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028065; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028214; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0028314; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028209; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028857; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027260; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027613; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000048430; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0066139; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0066197; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0066085; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0066117; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0065781; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0066592; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0066138; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0065730; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0065868; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0065795; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0065971; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0065779; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0066776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065680; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0064991; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..932
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /map="between Tyrp and Ifna"
FT                   /mol_type="mRNA"
FT                   /dev_stage="7.5 day embryo"
FT                   /db_xref="taxon:10090"
FT   CDS             42..860
FT                   /codon_start=1
FT                   /gene="Cer-1"
FT                   /product="cerberus homolog"
FT                   /note="cytokine; cystine knot containing protein; murine
FT                   homolog of the Xenopus head inducing factor cerberus"
FT                   /db_xref="GOA:O55233"
FT                   /db_xref="InterPro:IPR004133"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR016860"
FT                   /db_xref="MGI:MGI:1201414"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55233"
FT                   /protein_id="AAC02430.1"
FT                   /translation="MHLLLVQLLVLLPLGKADLCVDGCQSQGSLSFPLLERGRRDLHVA
FT                   NHEEAEDKPDLFVAVPHLMGTSLAGEGQRQRGKMLSRLGRFWKKPETEFYPPRDVESDH
FT                   VSSGMQAVTQPADGRKVERSPLQEEAKRFWHRFMFRKGPAFQGVILPIKSHEVHWETCR
FT                   TVPFNQTIAHEDCQKVVVQNNLCFGKCSSIRFPGEGADAHSFCSHCSPTKFTTVHLMLN
FT                   CTSPTPVVKMVMQVEECQCMVKTERGEERLLLAGSQGSFIPGLPASKTNP"
XX
SQ   Sequence 932 BP; 238 A; 244 C; 252 G; 198 T; 0 other;
     ccatctgtga atctaacctc agtctctggg aatcaggaag catgcatctc ctcttagttc        60
     agctgcttgt tctcttgcct ctggggaagg cagacctatg tgtggatggc tgccagagtc       120
     agggctcttt atcctttcct ctcctagaaa ggggtcgcag agatctccac gtggccaacc       180
     acgaggaggc agaagacaag ccggatctgt ttgtggccgt gccacacctc atgggcacca       240
     gcctggctgg ggaaggccag aggcagagag ggaagatgct gtccaggctt ggaagattct       300
     ggaagaaacc tgagaccgaa ttttaccccc caagggatgt ggaaagcgat catgtctcat       360
     cggggatgca ggccgtgact cagccagcag atgggaggaa agtggagaga tcacctctac       420
     aggaggaagc caagaggttc tggcatcggt tcatgttcag aaagggcccg gcgttccagg       480
     gagtcatcct gcccatcaaa agccacgaag tacactggga gacctgcagg actgtgccct       540
     tcaaccagac cattgcccat gaagactgtc aaaaagtcgt tgtccagaac aacctttgct       600
     ttggcaaatg cagttccatt cgttttcccg gagaaggggc agatgcccac agcttctgct       660
     cccactgctc gcccaccaaa ttcaccaccg tgcacttgat gctgaactgc accagcccaa       720
     cccccgtggt caagatggtg atgcaagtag aagagtgtca gtgcatggtg aagacggaac       780
     gtggagagga gcgcctccta ctggctggtt cccagggttc cttcatccct ggacttccag       840
     cttcaaaaac aaacccatga attacctcaa cagaaagcaa aacctcaaca gaataagtga       900
     gggttattca atctggaaat gttatgtgag tt                                     932
//