Dbfetch

ID   AF034744; SV 2; linear; mRNA; STD; MUS; 2793 BP.
XX
AC   AF034744;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   07-JAN-2017 (Rel. 131, Last updated, Version 6)
XX
DE   Mus musculus semaphorin M-SemaK mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2793
RX   DOI; 10.1016/S0306-4522(99)00134-7.
RX   PUBMED; 10430503.
RA   Miyazaki N., Furuyama T., Sakai T., Fujioka S., Mori T., Ohoka Y.,
RA   Takeda N., Kubo T., Inagaki S.;
RT   "Developmental localization of semaphorin H messenger RNA acting as a
RT   collapsing factor on sensory axons in the mouse brain";
RL   Neuroscience 93(1):401-408(1999).
XX
RN   [2]
RP   1-2793
RA   Miyazaki N., Furuyama T., Inagaki S.;
RT   ;
RL   Submitted (16-NOV-1997) to the INSDC.
RL   Neurobiology, School of Allied Health Sciences Osaka University Faculty of
RL   Medicine, 1-7 Yamadaoka, Suita, Osaka 565, Japan
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-2793
RA   Miyazaki N., Furuyama T., Inagaki S.;
RT   ;
RL   Submitted (05-JAN-2017) to the INSDC.
RL   Neurobiology, School of Allied Health Sciences Osaka University Faculty of
RL   Medicine, 1-7 Yamadaoka, Suita, Osaka 565, Japan
XX
DR   MD5; fb9dba4e21086a47bec429b053beed80.
DR   Ensembl-Gn; ENSMUSG00000063531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073957; mus_musculus.
XX
CC   On Jan 5, 2017 this sequence version replaced gi:4104333.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2793
FT                   /organism="Mus musculus"
FT                   /strain="C57/Black 6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             265..2592
FT                   /codon_start=1
FT                   /product="semaphorin M-SemaK"
FT                   /db_xref="GOA:P70275"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70275"
FT                   /protein_id="AAD01996.1"
FT                   /translation="MAPAGHILTLLLWGHLLELWTPGHSANPSYPRLRLSHKELLELNR
FT                   TSIFQSPLGFLDLHTMLLDEYQERLFVGGRDLVYSLNLERVSDGYREIYWPSTAVKVEE
FT                   CIMKGKDANECANYIRVLHHYNRTHLLTCATGAFDPHCAFIRVGHHSEEPLFHLESHRS
FT                   ERGRGRCPFDPNSSFVSTLVGNELFAGLYSDYWGRDSAIFRSMGKLGHIRTEHDDERLL
FT                   KEPKFVGSYMIPDNEDRDDNKMYFFFTEKALEAENNAHTIYTRVGRLCVNDMGGQRILV
FT                   NKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHA
FT                   VCVYHMSSIREAFNGPYAHKEGPEYHWSLYEGKVPYPRPGSCASKVNGGKYGTTKDYPD
FT                   DAIRFARMHPLMYQPIKPVHKKPILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTG
FT                   IVLKVITIYNQETEWMEEVILEELQIFKDPAPIISMEISSKRQQLYIGSASAVAQVRFH
FT                   HCDMYGSACADCCLARDPYCAWDGISCSRYYPTGAHAKRRFRRQDVRHGNAAQQCFGQQ
FT                   FVGDALDRTEERLAYGIESNSTLLECTPRSLQAKVIWFVQKGRDVRKEEVKTDDRVVKM
FT                   DLGLLFLRVRKSDAGTYFCQTVEHNFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHKM
FT                   PCPPLSGMSQGTKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYAN
FT                   PQEKRLRSKAEHFRLPRHTLLS"
XX
SQ   Sequence 2793 BP; 783 A; 658 C; 713 G; 638 T; 1 other;
     cagcccggac ctggctctca agacgcgctc cttggacggt ctcttgctcc gcgcttctaa        60
     ccaccgggcc caaggacaga aaggcttagc ggatccaaat attgcccggc aaatggcact       120
     tgggaatggt attttctgat gacaacccct tctgtttgtg acaaagcctg tcgcccgcag       180
     ttgcccctgg agggaagtac taagtaaaac tcaatcctgt cttaaagtgt ggctgcaggg       240
     gccagaggag agccagcacg caccatggca ccggccggac acatcctcac cttgctgctc       300
     tggggtcacc tgctggaact ctggacccca ggtcactccg cgaacccctc ctaccccagg       360
     ctacgcctgt cacataaaga acttttggaa ctgaatagga cttcaatatt tcaaagcccc       420
     cttggatttc ttgatctcca tacaatgctg ctggatgagt atcaagaacg gctctttgtg       480
     ggaggcagag accttgtcta ttccctgaac ttggaacgag tcagtgacgg ctacagagag       540
     atatactggc cgagcacagc agtaaaggta gaagaatgca taatgaaagg aaaagacgca       600
     aatgagtgtg ccaattatat ccgggttttg catcactaca acaggacaca ccttctgacc       660
     tgtgctactg gagcttttga tccacactgt gccttcatca gagtcgggca ccattcagag       720
     gaacccctgt ttcacctgga gtcacacaga tctgagagag gaaggggcag atgtcctttt       780
     gaccccaact cctcctttgt gtccacgcta gttgggaatg agctgtttgc tggactctac       840
     agtgactatt ggggcagaga ctcggcgatc ttccgcagca tggggaagtt aggccatatt       900
     cgcactgagc atgacgatga gcggctcctg aaagaaccaa aatttgtagg ttcatatatg       960
     attcctgata acgaagaccg agatgacaac aaaatgtact ttttctttac tgagaaggcg      1020
     ctggaggcgg agaacaacgc ccacacgatc tacacccgag tggggcggct gtgcgtgaat      1080
     gacatgggag gacagagaat cctggtgaac aagtggagca ctttccttaa agcgcggctg      1140
     gtttgctcag tgccgggaat gaatggaatc gacacatact ttgacgaact agaggatgtg      1200
     tttttactgc cgaccagaga tcctaagaat ccagtgatat ttggactgtt taatactacc      1260
     agcaatatat ttagaggcca tgctgtatgt gtgtatcaca tgtcaagtat ccgggaagcc      1320
     tttaatggcc catatgctca taaagaaggc cctgaatacc actggtcact atatgaagga      1380
     aaagtcccct acccaaggcc tggttcctgt gccagcaaag taaacggagg caagtatgga      1440
     accaccaaag attaccccga tgacgccatc cggttcgcaa ggatgcatcc tctaatgtat      1500
     cagcccataa aacctgttca taaaaaacca atactggtaa aaacagatgg aaaatacaac      1560
     ctgaggcaac ttgccgtgga tcgggtggaa gcggaggatg gccagtatga cgtcttattt      1620
     attgggacag acacaggaat tgtgctgaaa gtaatcacaa tttacaacca agaaacagag      1680
     tggatggagg aagtcattct agaggaactt caaatattca aggatccagc ccctatcatt      1740
     tctatggaaa tttcttcaaa gagacaacag ctttacattg gatcagcctc tgctgtggca      1800
     caagtcagat tccatcactg cgacatgtat ggcagtgctt gtgctgactg ctgcctggct      1860
     cgagacccgt actgtgcctg ggatggcata tcctgctcca ggtactaccc aacaggtgca      1920
     cacgcaaaga ggaggttccg caggcaggac gttcggcatg gcaacgccgc ccaacagtgc      1980
     tttggacagc aatttgttgg agacgcgttg gacaggactg aagagaggct ggcttatggc      2040
     atagagagca acagtactct gttggaatgc accccgcgat cactacaagc aaaagtcatc      2100
     tggtttgtac agaagggacg cgacgtaaga aaagaagagg tgaagacgga tgacagagtt      2160
     gtcaagatgg acttgggctt gctcttcctc agagtacgca agtcagatgc agggacctat      2220
     ttttgccaga cagtagaaca caattttgtc catactgtgc gtaaaatcac cttggaggtg      2280
     gtcgaagagc ataaagtgga gggcatgttt cataaggacc atgaagagga aagacatcac      2340
     aagatgccct gccctccctt aagcggtatg tctcagggga caaaaccgtg gtacaaggaa      2400
     ttcttgcagc tgattggcta cagcaacttc cagagagtgg aagaatactg cgaaaaggtg      2460
     tggtgtacag ataagaagag gaaaaagctt aaaatgtctc cctccaagtg gaagtatgcc      2520
     aacccccagg aaaagaggct tcgctctaaa gctgagcact tccgcctgcc caggcacacg      2580
     ctgctctcct gagggcgccc tctgccggcg gctgaggaac ctaggatgga aacatttttt      2640
     taaagggggg gaaaaaaaaa agactgaaag catgcagtct ctttccatta cttcaaagaa      2700
     ctttctgtag tactnagagg ctgggaaggt gttttaagtt attctgcata ttcatctgac      2760
     tgtacaaaca tctctctcac agtacttggt act                                   2793
//