spacer

EBI Dbfetch

ID   AF034744; SV 1; linear; mRNA; STD; MUS; 2898 BP.
XX
AC   AF034744;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus semaphorin M-SemaK mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2898
RX   DOI; 10.1016/S0306-4522(99)00134-7.
RX   PUBMED; 10430503.
RA   Miyazaki N., Furuyama T., Sakai T., Fujioka S., Mori T., Ohoka Y.,
RA   Takeda N., Kubo T., Inagaki S.;
RT   "Developmental localization of semaphorin H messenger RNA acting as a
RT   collapsing factor on sensory axons in the mouse brain";
RL   Neuroscience 93(1):401-408(1999).
XX
RN   [2]
RP   1-2898
RA   Miyazaki N., Furuyama T., Inagaki S.;
RT   ;
RL   Submitted (16-NOV-1997) to the INSDC.
RL   Neurobiology, School of Allied Health Sciences Osaka University Faculty of
RL   Medicine, 1-7 Yamadaoka, Suita, Osaka 565, Japan
XX
DR   MD5; e227e0d5656f01bf92aefb3f3d188afa.
DR   Ensembl-Gn; ENSMUSG00000063531; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073957; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2898
FT                   /organism="Mus musculus"
FT                   /strain="C57/Black 6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             370..2697
FT                   /codon_start=1
FT                   /product="semaphorin M-SemaK"
FT                   /db_xref="GOA:P70275"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013151"
FT                   /db_xref="InterPro:IPR015513"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:1340034"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70275"
FT                   /protein_id="AAD01996.1"
FT                   /translation="MAPAGHILTLLLWGHLLELWTPGHSANPSYPRLRLSHKELLELNR
FT                   TSIFQSPLGFLDLHTMLLDEYQERLFVGGRDLVYSLNLERVSDGYREIYWPSTAVKVEE
FT                   CIMKGKDANECANYIRVLHHYNRTHLLTCATGAFDPHCAFIRVGHHSEEPLFHLESHRS
FT                   ERGRGRCPFDPNSSFVSTLVGNELFAGLYSDYWGRDSAIFRSMGKLGHIRTEHDDERLL
FT                   KEPKFVGSYMIPDNEDRDDNKMYFFFTEKALEAENNAHTIYTRVGRLCVNDMGGQRILV
FT                   NKWSTFLKARLVCSVPGMNGIDTYFDELEDVFLLPTRDPKNPVIFGLFNTTSNIFRGHA
FT                   VCVYHMSSIREAFNGPYAHKEGPEYHWSLYEGKVPYPRPGSCASKVNGGKYGTTKDYPD
FT                   DAIRFARMHPLMYQPIKPVHKKPILVKTDGKYNLRQLAVDRVEAEDGQYDVLFIGTDTG
FT                   IVLKVITIYNQETEWMEEVILEELQIFKDPAPIISMEISSKRQQLYIGSASAVAQVRFH
FT                   HCDMYGSACADCCLARDPYCAWDGISCSRYYPTGAHAKRRFRRQDVRHGNAAQQCFGQQ
FT                   FVGDALDRTEERLAYGIESNSTLLECTPRSLQAKVIWFVQKGRDVRKEEVKTDDRVVKM
FT                   DLGLLFLRVRKSDAGTYFCQTVEHNFVHTVRKITLEVVEEHKVEGMFHKDHEEERHHKM
FT                   PCPPLSGMSQGTKPWYKEFLQLIGYSNFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYAN
FT                   PQEKRLRSKAEHFRLPRHTLLS"
XX
SQ   Sequence 2898 BP; 794 A; 695 C; 748 G; 660 T; 1 other;
     ctgcaggatg gccctgtcct gttcggtgac tcggctctgc ttcttgcggc cgaacaggtt        60
     gcccatggcg gccccgcgcc ggctcgtgcc gaattcggca cgagccagcc cggacctggc       120
     tctcaagacg cgctccttgg acggtctctt gctccgcgct tctaaccacc gggcccaagg       180
     acagaaaggc ttagcggatc caaatattgc ccggcaaatg gcacttggga atggtatttt       240
     ctgatgacaa ccccttctgt ttgtgacaaa gcctgtcgcc cgcagttgcc cctggaggga       300
     agtactaagt aaaactcaat cctgtcttaa agtgtggctg caggggccag aggagagcca       360
     gcacgcacca tggcaccggc cggacacatc ctcaccttgc tgctctgggg tcacctgctg       420
     gaactctgga ccccaggtca ctccgcgaac ccctcctacc ccaggctacg cctgtcacat       480
     aaagaacttt tggaactgaa taggacttca atatttcaaa gcccccttgg atttcttgat       540
     ctccatacaa tgctgctgga tgagtatcaa gaacggctct ttgtgggagg cagagacctt       600
     gtctattccc tgaacttgga acgagtcagt gacggctaca gagagatata ctggccgagc       660
     acagcagtaa aggtagaaga atgcataatg aaaggaaaag acgcaaatga gtgtgccaat       720
     tatatccggg ttttgcatca ctacaacagg acacaccttc tgacctgtgc tactggagct       780
     tttgatccac actgtgcctt catcagagtc gggcaccatt cagaggaacc cctgtttcac       840
     ctggagtcac acagatctga gagaggaagg ggcagatgtc cttttgaccc caactcctcc       900
     tttgtgtcca cgctagttgg gaatgagctg tttgctggac tctacagtga ctattggggc       960
     agagactcgg cgatcttccg cagcatgggg aagttaggcc atattcgcac tgagcatgac      1020
     gatgagcggc tcctgaaaga accaaaattt gtaggttcat atatgattcc tgataacgaa      1080
     gaccgagatg acaacaaaat gtactttttc tttactgaga aggcgctgga ggcggagaac      1140
     aacgcccaca cgatctacac ccgagtgggg cggctgtgcg tgaatgacat gggaggacag      1200
     agaatcctgg tgaacaagtg gagcactttc cttaaagcgc ggctggtttg ctcagtgccg      1260
     ggaatgaatg gaatcgacac atactttgac gaactagagg atgtgttttt actgccgacc      1320
     agagatccta agaatccagt gatatttgga ctgtttaata ctaccagcaa tatatttaga      1380
     ggccatgctg tatgtgtgta tcacatgtca agtatccggg aagcctttaa tggcccatat      1440
     gctcataaag aaggccctga ataccactgg tcactatatg aaggaaaagt cccctaccca      1500
     aggcctggtt cctgtgccag caaagtaaac ggaggcaagt atggaaccac caaagattac      1560
     cccgatgacg ccatccggtt cgcaaggatg catcctctaa tgtatcagcc cataaaacct      1620
     gttcataaaa aaccaatact ggtaaaaaca gatggaaaat acaacctgag gcaacttgcc      1680
     gtggatcggg tggaagcgga ggatggccag tatgacgtct tatttattgg gacagacaca      1740
     ggaattgtgc tgaaagtaat cacaatttac aaccaagaaa cagagtggat ggaggaagtc      1800
     attctagagg aacttcaaat attcaaggat ccagccccta tcatttctat ggaaatttct      1860
     tcaaagagac aacagcttta cattggatca gcctctgctg tggcacaagt cagattccat      1920
     cactgcgaca tgtatggcag tgcttgtgct gactgctgcc tggctcgaga cccgtactgt      1980
     gcctgggatg gcatatcctg ctccaggtac tacccaacag gtgcacacgc aaagaggagg      2040
     ttccgcaggc aggacgttcg gcatggcaac gccgcccaac agtgctttgg acagcaattt      2100
     gttggagacg cgttggacag gactgaagag aggctggctt atggcataga gagcaacagt      2160
     actctgttgg aatgcacccc gcgatcacta caagcaaaag tcatctggtt tgtacagaag      2220
     ggacgcgacg taagaaaaga agaggtgaag acggatgaca gagttgtcaa gatggacttg      2280
     ggcttgctct tcctcagagt acgcaagtca gatgcaggga cctatttttg ccagacagta      2340
     gaacacaatt ttgtccatac tgtgcgtaaa atcaccttgg aggtggtcga agagcataaa      2400
     gtggagggca tgtttcataa ggaccatgaa gaggaaagac atcacaagat gccctgccct      2460
     cccttaagcg gtatgtctca ggggacaaaa ccgtggtaca aggaattctt gcagctgatt      2520
     ggctacagca acttccagag agtggaagaa tactgcgaaa aggtgtggtg tacagataag      2580
     aagaggaaaa agcttaaaat gtctccctcc aagtggaagt atgccaaccc ccaggaaaag      2640
     aggcttcgct ctaaagctga gcacttccgc ctgcccaggc acacgctgct ctcctgaggg      2700
     cgccctctgc cggcggctga ggaacctagg atggaaacat ttttttaaag ggggggaaaa      2760
     aaaaaagact gaaagcatgc agtctctttc cattacttca aagaactttc tgtagtactn      2820
     agaggctggg aaggtgtttt aagttattct gcatattcat ctgactgtac aaacatctct      2880
     ctcacagtac ttggtact                                                    2898
//


spacer
spacer