spacer

EBI Dbfetch

ID   AF033585; SV 2; linear; mRNA; STD; MUS; 1948 BP.
XX
AC   AF033585;
XX
DT   30-NOV-1997 (Rel. 53, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus frizzled-9 protein (Mfz9) mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1948
RA   Van-Raay T.J., Rasmussen J.T., Rao M.S.;
RT   "A Novel Mouse Frizzled Gene Expressed in Early Neural Development";
RL   Unpublished.
XX
RN   [2]
RP   660-1948
RA   Van-Raay T.J., Rasmussen J.T., Rao M.S.;
RT   ;
RL   Submitted (07-NOV-1997) to the INSDC.
RL   Neurobiology and Anantomy, University of Utah, 50 North Medical Drive, Salt
RL   Lake City, UT 84132, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1948
RA   Van-Raay T.J., Rasmussen J.T., Rao M.S.;
RT   ;
RL   Submitted (11-JUN-1999) to the INSDC.
RL   Neurobiology and Anantomy, University of Utah, 50 North Medical Drive, Salt
RL   Lake City, UT 84132, USA
XX
DR   MD5; 43805ef2a698f74a472bd140c61c7474.
DR   Ensembl-Gn; ENSMUSG00000049551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062572; mus_musculus.
XX
CC   On Jun 11, 1999 this sequence version replaced gi:2645807.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1948
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10.5 day embryo"
FT                   /clone_lib="Life Technologies Superscript Mouse 10.5 Day
FT                   Embryo cDNA Library"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1652
FT                   /codon_start=3
FT                   /gene="Mfz9"
FT                   /product="frizzled-9 protein"
FT                   /db_xref="GOA:Q9R216"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:1313278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R216"
FT                   /protein_id="AAB87503.2"
FT                   /translation="EIPMCRGIGYNLTRMPNLLGHTPQGEAAAQLAEFSPLVQYGCHSH
FT                   LRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRN
FT                   DPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARPPGDSAPGPGSGGTCDNPEKFQYV
FT                   EKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPE
FT                   RPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQEDLENTGCTLVFLLLYYF
FT                   GMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGD
FT                   ELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKL
FT                   EKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATEQPCTAATVPGGRRDCSLP
FT                   GGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCYRKMAAGRARAKACRTPG
FT                   GYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL"
XX
SQ   Sequence 1948 BP; 368 A; 601 C; 562 G; 417 T; 0 other;
     tggagatccc catgtgccgg ggcattggct acaacctgac ccgcatgccc aacctactgg        60
     gccacacgcc gcagggcgag gcggcggcgc agctggccga gttctcgccc ctcgtgcagt       120
     acggctgcca cagccacctg cgcttcttcc tctgctcgct ctacgcccca atgtgcaccg       180
     accaggtctc cactcccatc ccagcctgcc ggcccatgtg cgagcaggct cgcctgcgct       240
     gcgcccccat catggagcaa ttcaatttcg gctggcccga ctcactcgac tgtgcccggc       300
     tccccacgcg caacgacccg cacgcactct gtatggaggc acccgagaac gctacagcag       360
     gccccacaga accccacaag ggcctgggca tgctccctgt ggcacctcgg cccgcgaggc       420
     caccgggaga ttcagcccca ggtcccggca gcggtggcac ctgcgacaac cccgagaagt       480
     tccagtacgt ggagaagagt cgctcgtgcg ctccgcgctg cgggccaggc gtcgaggtgt       540
     tctggtctcg gcgcgataag gacttcgcgc tggtttggat ggctgtgtgg tccgcgttgt       600
     gtttcttctc cacggccttc accgtgttca ccttcctgct ggagcctcac cggttccagt       660
     acccagagcg cccgattatc ttcctttcta tgtgctacaa tgtctactcc ttggccttcc       720
     tgatcagagc ggtggcaggt gcacagagtg tggcatgcga ccaggaggca ggggctctgt       780
     atgtgatcca ggaggatctg gaaaacacag gctgcaccct ggtcttcctg ttgctctatt       840
     atttcgggat ggccagctca ctttggtggg tggttttgac tctaacctgg ttcctggctg       900
     caggcaaaaa atggggccac gaggccatcg aggctcacgg cagctacttc cacatggcag       960
     cgtggggcct gccagcactc aaaactatcg tggtcctgac tctgcgcaag gtggctggcg      1020
     atgaactgac tgggctctgc tatgtagcca gcatggaccc ggcagccctc actggctttg      1080
     tgttggtacc cctatcttgc tacctggtac tgggtaccag tttcctcctg accggttttg      1140
     tggctctctt ccatatccgc aaaatcatga agacgggagg caccaatacg gagaagctgg      1200
     agaagctgat ggtcaaaatc ggagtctttt ccatccttta cacagtgccg gccacctgcg      1260
     tcattgtctg ctacgtttat gaacgcctca acatggactt ctggcggctt cgggccacag      1320
     agcaaccatg tactgctgcc accgtgcctg gaggccggag agactgctcg ctgccagggg      1380
     gctcggtgcc cactgtggct gtcttcatgc tcaaaatctt catgtccttg gtggtgggca      1440
     tcaccagtgg agtctgggta tggagttcca agacttttca gacttggcag agcctgtgct      1500
     accgaaaaat ggcagctggc cgagcccggg ccaaggcctg ccgaacccca gggggctatg      1560
     gccggggtac ccactgccac tacaaagccc ccacggtggt cttgcacatg actaagacag      1620
     acccctctct ggagaacccc acacacctct agaacatagg ctaggctgtg agttatggtt      1680
     gctccctcct tgccctcccc tccccccttc agagacagct gactaacagc tgcccagctg      1740
     tcaaggtcag acaagtgaga cacagggggc tgaggactag ggtggggacc cagtaaagct      1800
     cagggccttg accttctgtc tcatgcaggg agtggtccta gtccacagag ggtcccagga      1860
     taagaagggg cagaaggggg cagggtccag tgcagagtta tttaatgatg taatttattg      1920
     tggcatttct ctggaagctg tgactgga                                         1948
//


spacer
spacer