Dbfetch

ID   AF031816; SV 1; linear; mRNA; STD; MUS; 6909 BP.
XX
AC   AF031816;
XX
DT   02-DEC-1997 (Rel. 53, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus hybrid receptor gp250 precursor, mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-6909
RX   DOI; 10.1016/S0925-4773(97)00177-9.
RX   PUBMED; 9510025.
RA   Hermans-Borgmeyer I., Hampe W., Schinke B., Methner A., Nykjaer A.,
RA   Susens U., Fenger U., Herbarth B., Schaller H.C.;
RT   "Unique expression pattern of a novel mosaic receptor in the developing
RT   cerebral cortex";
RL   Mech. Dev. 70(1-2):65-76(1998).
XX
RN   [2]
RP   1-6909
RA   Hampe W., Fenger U., Methner A., Nykjaer A.;
RT   ;
RL   Submitted (29-OCT-1997) to the INSDC.
RL   Zentrum fuer Molekulare Neurobiologie, University Hamburg, Martinistr. 52,
RL   Hamburg D20246, Germany
XX
DR   MD5; b33cdb56af77f82ac992c14b564da2f2.
DR   Ensembl-Gn; ENSMUSG00000049313; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034675; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034655; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034581; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034646; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034357; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035169; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033680; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034330; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034489; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034429; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034570; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034473; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035188; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033385; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033793; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000060989; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091943; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0092013; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091959; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091939; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0091514; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0092472; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0092112; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0091448; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091656; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0091491; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091669; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0091501; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092782; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0091543; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0090544; mus_musculus_wsbeij.
DR   EuropePMC; PMC2954693; 21102985.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6909
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_line="neuroblastoma x glioma cell line NH15-CA2"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..6102
FT                   /codon_start=1
FT                   /product="gp250 precursor"
FT                   /note="hybrid receptor"
FT                   /db_xref="GOA:O88307"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR002172"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023415"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="MGI:MGI:1202296"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88307"
FT                   /protein_id="AAC16739.1"
FT                   /translation="YAQYLWITFDFCSTIHGFSIPFRAADLLLHSKASNLLLGFDRSHP
FT                   NKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDQPNAIYIERHEPFGFSTVLRSTDFFQS
FT                   RENQEVILEEVRDFQLRDKYMFATKVVHLPGSQQQSSVQLWVSFGRKPMRAAQFVTKHP
FT                   INEYYIADAAEDQVFVCVSHSNNSTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVR
FT                   YFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGE
FT                   KINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYI
FT                   SSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFVFSEKPV
FT                   FVYGLLTEPGEKSTVFTIFGSNKESVHSWLILQVNATDALGVPCTENDYKLWSPSDERG
FT                   NECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVC
FT                   VPDPEFFGKPYSPPVPCPVGSSYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEEN
FT                   EFILYAMRKFIYRYDLASGATEQLPLSGLRAAVALDFGYERNCLYWSDLALDTIQRLCL
FT                   NGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLD
FT                   RPRALVLVPQEGVMFWTDWGDLKPGIYRSYMDGSAAYRLVSEDVKWPNGISVDSQWIYW
FT                   TDAYLDCIERITFSGQQRSVILDSLPHPYAIAVFKNEIYWDDWSQLSIFRASKHSRSQV
FT                   EILASQLTGLMDMKVFYKGKNAGSNACVPQPCSLLCLPKANNSKSCRCPEGVASSVLPS
FT                   GDLMCDCPQGYQRKNNTCVKEENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNC
FT                   PTTVCDADTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEFNCSSGMCI
FT                   RSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCHNGHCIPQRWACDGDADCQDGSDE
FT                   DPVSCEKKCNGFHCPNGTCIPSSKHCDGLRDCPDGSDEQHCEPFCTRFMDFVCKNRQQC
FT                   LFHSMVCDGIVQCRDGSDEDAAFAGCSQDPEFHKECDEFGFQCQNGVCISLIWKCDGMD
FT                   DCGDYSDEANCENPTEAPNCSRYFQFHCENGHCIPNRWKCDRENDCGDWSDEKDCGDSH
FT                   VLPSPTPGPSTCLPNYFRCSSGACVMGTWVCDGYRDCADGSDEEACPSLANSTAASTPT
FT                   QLGQCDRFEFECHQPKKCIPNWKRCDGHQDCQDGQDEANCPTHSTLTCTSREFKCEDGE
FT                   ACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSA
FT                   SCVYNVYYRVVGESIWKTLETHSNKTSTVLKVLKPDTTYQVKVQVHCLNKVHNTNDFVT
FT                   LRTPEGLPDAPRNLQLSLNREEEGVILGHWAPPVHTHGLIREYIVEYSRSGSKMWASQR
FT                   AASNSTEIKNLLLNALYTVRVAAVTSRGIGNWSDSKSITTIKGKVIQAPNIHIDSYDEN
FT                   SLSFTLTMDGDIKVNGYVVNLFWSFDAHKQEKKTLSFRGGSALSHKVSNLTAHTSYEIS
FT                   AWAKTDLGDSPLAFEHILTRGSSPPAPSLKAKAINQTAVECIWTGPKNVVYGIFYATSF
FT                   LDLYRNPKSVTTSLHNKTVIVSKDEQYLFLVRVLIPYQGPSSDYVVVKMIPDSRLPPRH
FT                   LHAVHIGKTSALIKWESPYDSPDQDLFYAIAVKDLIRKTDRSYKVRSRNSTVEYSLSKL
FT                   EPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKQFNE
FT                   TRGYEIHMSDSAVNLTAYLGNTTDNFFKVSNLKMGHNYTFTVQARCLFGSQICGEPAVL
FT                   LYDELSSGADAAVIQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFSAFA
FT                   NSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA"
FT   variation       1335
FT                   /replace="g"
FT   variation       1338
FT                   /replace="t"
FT   variation       1425
FT                   /replace="t"
FT   variation       1431
FT                   /replace="g"
FT   variation       1443
FT                   /replace="a"
FT   variation       1446
FT                   /replace="g"
FT   variation       2346
FT                   /replace="c"
FT   variation       4017
FT                   /replace="t"
FT   variation       4203
FT                   /replace="c"
FT   variation       5599
FT                   /replace="c"
FT   variation       5655
FT                   /replace="c"
FT   variation       5805
FT                   /replace="c"
FT   variation       5955
FT                   /replace="a"
FT   variation       5979
FT                   /replace="c"
FT   variation       6225..6335
FT                   /note="from 11 to 25 A's can be found at this location"
FT   variation       6243
FT                   /replace="g"
FT   regulatory      6253
FT                   /regulatory_class="polyA_signal_sequence"
FT   variation       6308
FT                   /replace="g"
FT   regulatory      6438
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 6909 BP; 1691 A; 1757 C; 1812 G; 1649 T; 0 other;
     tacgcccaat acctctggat cacgtttgac ttctgcagca ctatccatgg cttctccatc        60
     ccattccggg cggctgatct cctcctccat agcaaggcct ccaacctcct cttgggcttt       120
     gacaggtctc accccaacaa gcagctatgg aagtcagatg attttggcca gacctggatc       180
     atgattcagg aacacgtgaa gtccttctct tggggaatcg acccctatga tcagccaaac       240
     gctatctaca ttgagcgaca tgaacccttt gggttctcca cagtgctccg cagtacagac       300
     ttcttccagt cccgggaaaa ccaggaagtg atcctggagg aagtgagaga ctttcagctt       360
     cgggacaagt acatgtttgc tacaaaggtg gtgcatcttc cgggcagcca gcagcagtca       420
     tctgtccagc tctgggtctc ctttggccgg aagcctatga gagcagccca gtttgtcaca       480
     aagcatccta ttaatgaata ttacatcgct gatgccgccg aggaccaggt gtttgtgtgt       540
     gttagccaca gtaacaacag cactaaccta tacatctcag aggcggaggg gctgaagttc       600
     tccctctcct tggagaatgt gctgtattac agcccaggag gggctggcag tgacactctg       660
     gtgaggtatt ttgcaaatga gccgtttgcc gactttcacc gcgtggaagg cttacaagga       720
     gtctatattg ccaccctgat taatggttct atgaatgagg agaacatgag gtcggtcatc       780
     acctttgaca aagggggaac ctgggaattt cttcaggccc cagccttcac aggatatgga       840
     gagaaaatca attgtgagct ttctcagggt tgttccctcc acctggccca gcgcctcagt       900
     caactgctca acctccaact tcggaggatg cctatcctat ccaaggagtc agcccccggt       960
     ctcatcattg ctaccggctc tgtgggaaag aacttggcca gcaagaccaa tgtgtacatc      1020
     tctagcagtg ctggagccag gtggagagag gctcttcccg gacctcatta ctatacttgg      1080
     ggtgaccatg gaggcatcat catggcgatt gcccagggca tggagaccaa cgagctgaag      1140
     tacagcacca atgaagggga gacctggaag acgttcgtct tctcggagaa gcctgtgttt      1200
     gtgtatgggc ttctcacaga acctggtgag aagagcaccg tcttcaccat cttcggctcg      1260
     aacaaggaga gtgtccacag ctggctcatc ctgcaagtca atgccactga tgccttgggg      1320
     gttccttgca cagaaaacga ctacaagctg tggtccccat ctgatgagcg aggaaatgag      1380
     tgtttgctag gacacaagac agttttcaaa aggaggaccc ctcacgccac atgctttaat      1440
     ggggaagact ttgaccggcc agtggttgtg tccaactgct cctgcacccg ggaggactac      1500
     gaatgtgact ttggcttcaa gatgagcgaa gatctctcct tagaggtttg tgttccagac      1560
     cctgagtttt ttgggaagcc ctacagccct cctgtgcctt gtcctgtggg ttcttcatac      1620
     aggagaacga gaggctatcg gaagatttct ggggatacgt gcagtggagg agacgttgaa      1680
     gcgcggctgg aaggggagct ggtcccctgt ccccttgcag aagagaatga gttcatccta      1740
     tacgccatgc gcaagttcat ctaccgctac gacttggcct cgggagccac agagcagctt      1800
     cctctctcgg ggctgcgggc ggctgtggcc ctggactttg gctatgaacg caactgcttg      1860
     tattggtctg acctggcgct ggacaccatc cagcgtctct gcttgaacgg gagcacaggg      1920
     caggaggtga tcatcaattc cggcctggag accgtggagg ctttggcctt cgaacccctc      1980
     agccaattac tttactgggt ggatgccggc tttaaaaaga tcgaggtagc taatccagat      2040
     ggtgacttcc gactgacaat cgtcaattcc tctgtgcttg atcgacccag ggctttagtc      2100
     cttgtacccc aagaaggggt gatgttctgg actgactggg gggacctgaa gcctgggatt      2160
     taccggagct acatggacgg ctctgctgcc taccgccttg tgtcagagga cgtgaagtgg      2220
     cccaatggca tctctgtgga cagccagtgg atctactgga cggatgctta cctggactgt      2280
     atcgagcgca tcactttcag tggccagcag cgttcagtca tccttgacag cctcccacac      2340
     ccctatgcca tcgctgtctt taagaatgag atctactggg acgactggtc acagctcagc      2400
     atcttcagag cttcgaagca cagcagatcc caggtggaga ttctagcaag ccagctcacg      2460
     ggcctcatgg acatgaaggt tttctacaag ggaaagaatg ctggaagcaa tgcttgcgtc      2520
     cctcagccct gcagtctact gtgcctccct aaggccaaca acagcaaaag ctgcaggtgt      2580
     ccagaaggtg tggccagcag tgtcctcccc tctggggacc tgatgtgtga ctgccctcag      2640
     ggctatcaaa ggaagaacaa cacctgtgtc aaagaagaga acacctgtct ccgcaaccag      2700
     taccgctgca gcaacggcaa ctgtatcaac agcatttggt ggtgtgattt cgacaatgac      2760
     tgtggagaca tgagtgacga gagaaattgc cccacgacgg tctgtgatgc agacactcag      2820
     ttccggtgcc aggagtcggg gacttgcatt ccactctcct ataagtgtga ccttgaagat      2880
     gactgtggag ataacagtga tgagagtcac tgtgagatgc accagtgtcg tagcgacgag      2940
     ttcaactgca gctctgggat gtgcatccgg tcctcctggg tgtgtgatgg agacaacgac      3000
     tgtagggact ggtctgatga agccaactgt actgccatct atcatacctg tgaggcctcc      3060
     aacttccagt gccacaatgg ccactgcatc ccccagcgat gggcatgtga cggtgatgcg      3120
     gattgccagg atggctctga tgaagatccc gtcagctgtg agaaaaagtg caacggattc      3180
     cactgcccaa acggcacgtg catcccgtcc agcaagcatt gtgatgggct gagggactgc      3240
     cccgacggct ccgatgagca gcactgtgag cccttctgca cgcgcttcat ggacttcgtg      3300
     tgtaagaacc gtcagcagtg tctgttccac tccatggtgt gtgacgggat cgtccagtgc      3360
     cgagatggct ctgatgagga tgcggccttc gctggatgct cgcaagaccc cgagttccac      3420
     aaggagtgcg atgagttcgg cttccagtgt cagaacggag tgtgcatcag cttgatttgg      3480
     aaatgcgatg ggatggatga ctgcggggac tactctgacg aggccaactg tgaaaacccc      3540
     acagaagccc caaactgttc ccgttacttt cagttccact gtgagaatgg ccactgcatc      3600
     cccaacaggt ggaaatgtga cagagagaac gactgtgggg actggtctga tgagaaggat      3660
     tgtggagatt cacatgtttt gccctccccg acccccgggc cctccacgtg tctgcccaat      3720
     tacttccgct gcagcagcgg ggcctgtgtg atgggcacct gggtgtgcga cggctacagg      3780
     gactgtgcag atggctctga tgaggaggcc tgcccctctc tagcaaactc cactgccgcc      3840
     tccactccca cccagctcgg gcagtgcgac cgatttgagt tcgagtgtca ccaaccaaag      3900
     aaatgtatcc ccaactggaa gcgctgtgac ggccaccaag attgccaaga cggccaggat      3960
     gaagccaact gccccactca cagcaccttg acctgtacga gcagggagtt caagtgcgag      4020
     gacggcgagg catgcatcgt gctctcagag cgctgtgatg gcttcctgga ttgctccgat      4080
     gagagcgatg agaaggcctg cagcgatgag ttaactgtat acaaagtgca gaatctccag      4140
     tggacagctg atttctccgg ggatgtgact ttgacctgga tgcggccaaa gaaaatgcca      4200
     tctgcttctt gtgtatacaa tgtctactac agggtggttg gagagagcat atggaagacc      4260
     ctggaaaccc acagcaataa aacaagcact gtgctcaagg tcctgaagcc agacaccacg      4320
     taccaggtta aggtccaggt gcactgcctc aacaaggtgc acaacaccaa tgactttgtg      4380
     accctcagga ctccagaagg gttgccagat gcccctcgga atctccagct ctccctgaac      4440
     agggaagagg aaggtgtgat tctcgggcac tgggctcctc ccgtccacac ccatggcctc      4500
     atccgtgagt acattgtgga atacagcagg agtgggtcca agatgtgggc ctcccagaga      4560
     gctgctagca actctacaga aataaagaac ttactgctca atgccctcta cactgtcaga      4620
     gtggctgcgg tgactagtcg tgggatagga aactggagtg attctaagtc catcaccacc      4680
     ataaaaggaa aagtgatcca agcaccaaat atccacattg acagctacga tgaaaattct      4740
     ctgagcttta ccctgaccat ggatggtgac atcaaggtca atggctacgt ggtgaacctt      4800
     ttctggtcat ttgatgccca caaacaagaa aagaaaaccc tgagcttccg cggagggagt      4860
     gcactgtcac acaaagttag caacctgaca gctcatacat cctatgagat ttctgcctgg      4920
     gccaagacag acttgggaga tagcccactg gcctttgagc acatcttgac cagaggcagc      4980
     agtccaccag ctcctagtct caaagccaag gccatcaatc agactgcagt ggagtgcatc      5040
     tggactggcc ccaagaatgt ggtgtatggt attttctatg ccacatcctt ccttgacctc      5100
     taccgaaacc ctaagagcgt aactacttcg ctccacaata agacagtcat cgtcagcaag      5160
     gatgagcagt atctgtttct ggtccgggtg ttgatccctt accaagggcc gtcttctgac      5220
     tacgttgtag tgaagatgat cccagacagc aggctcccac ctcgccatct gcacgcggtc      5280
     cacataggca aaacctcagc actcatcaaa tgggaatcgc cctatgactc tcctgaccag      5340
     gacttgttct acgccattgc agtgaaagat ctgatcagga agacggacag aagctacaaa      5400
     gtcagatccc gcaacagtac tgtggagtac agcctaagca agctggaacc tggagggaaa      5460
     taccacatca ttgtccagct gggaaacatg agcaaggatt ccagcataaa aatcaccaca      5520
     gtttcgttat cagcacctga tgccttaaaa atcataacgg aaaacgacca cgttctcctc      5580
     ttttggaaaa gcctagcatt gaaggaaaag cagttcaatg aaaccagggg ctatgagatc      5640
     cacatgtctg acagtgctgt gaatctcacc gcttacctcg ggaatactac ggacaatttc      5700
     tttaaagtgt ccaacctgaa gatgggtcat aactacactt tcacggtcca agcgcggtgt      5760
     ctctttggta gccagatctg tggggagccc gccgtgctgc tgtatgatga actgagctca      5820
     ggtgcagatg cggcagtgat ccaggctgcc cggtctactg atgttgcagc tgtggtggtt      5880
     cccatcctgt tcctgatcct gctgagcctg ggtgtcggct tcgccatcct ctacacgaag      5940
     caccgtcgct tacagagcag cttcagcgct ttcgccaata gccactacag ctccaggctg      6000
     ggctcggcca tcttctcctc aggggatgac ctaggagagg acgatgaaga tgctcccatg      6060
     attactggat tctcagacga tgtccccatg gtgatagcgt gaagagcttt tctcattaga      6120
     aaccaaatgg tgtaaatatt ttatttgata aagatagttg atggtttatt ttaaaagatg      6180
     cactttgagt tgcaatatgt tatttttata tgggccaaaa ctacaaaaaa aaaaagagga      6240
     aaagaaggaa tgaataaact ttgtagtatc aactgtgaac tgaaaccagg ttgattttag      6300
     taaccacatt ctttgatttg acattgatgt catcttacag ggctgcgctt gctgggcatg      6360
     cttttaagtc tgtgagatca ttttgcttca ttaagttgac cattcttttt gtttttctaa      6420
     gacacagaaa tgtatttaat aaaaccttca agagagagta atggacggag tgcattctcc      6480
     ttgaaaactg ttcagagttt acgtctcgtt tgggttcagt tacataagtg tgtgggtgtc      6540
     ttgtggggga aggttctgtg ctcttgtttt tgttaattta ttggaactct gtataaggcc      6600
     atattttagt ggctgtctga aaccccatgt gtgaagggcc ccttgcccaa cagggttgag      6660
     gtagggagca agagcaatct gtttttattt gctcgtatgt cagggacagg tgtttggcag      6720
     aagagacttc taggttactg ctagattcca attcaactgc cttgtagcct gggaagccca      6780
     gcaagtcata acctcctgtc ttctaggaac ccgtgggctt ttactgtgca tgtctctgta      6840
     caaagtgtac ctctggaagc tgccaagtga taacactgct ttcttataca ctgggatcat      6900
     tgtcacttg                                                              6909
//